KEGG   Anaerostipes rhamnosivorans: AR1Y2_2776
Entry
AR1Y2_2776        CDS       T05962                                 

Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00230  Purine metabolism
arf01100  Metabolic pathways
arf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AR1Y2_2776
Enzymes [BR:arf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AR1Y2_2776
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QCP36230
UniProt: A0A4V1EGI8
Position
2774507..2776792
AA seq 761 aa
MKTVGQSIKRVDAYEKVTGRAKYTDDLILNRCLFAKVLHAPIANGIVTSIDTSEAEALDG
VVKVVTFHEVPTHTYPTPGHPWSVEQSHQDVADRHLLTGRIRYYGDDIATVVAEDEVTAS
RALKLIKAEYEEYPPVLHPRDAMKGSSPPVHAENPDNILAKSGYEIGHVEEALLASDIVL
KESFCTPMVQHCHIEAPISYAYMEKDRIVVVSSTQIPHIVKRVIGQALGIPWGKVRVIKP
YIGGGFGNKQDVLYEPLNAFLTTLVGGRPVKLDLSREETFANTRTRHSIEYDLTAGVSKE
GKILAKDMKAYSNQGAYASHGHAIAANGATAWRHMYDVKNIRADAYTVYTNTPVGGAMRG
YGIPQFCFVSECLMDDMAHKLSMDPLKFRELNLYDGYFEDPVLTPIAANTNGIRECMRRG
ADYIHWEEKRDLYKNQTGDKRRGVGMALFSYKTGVWPISLEISGARLILNQDGSVQLQTG
AAEIGQGSDTVFTQMAADVLGLCPEDVHIQSFQDTDITPFDTGAYASRQTYISGTAVKEC
AELLREKILSYARTLISEEYKDRELKLSEKQIWCGKESVLSLEELALESYYSRSSSSAIT
SDISRQIKKNTIAFGACFAEIEVDLKLSKIRILDIINVHDSGKIINPQLASMQVHGGMSM
GIGYGLSEQMLLDEQTGRVLNGTLLDYKLPTAMDAPDLHLDFVELEDPTGPFGNKALGEP
PAIPPAPAIRNAFLNATGVAVNEIPLSPQRVFQELRKAGLV
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgaaaacagttggtcagagtataaaaagagtggatgcttatgaaaaggttaccgggaga
gccaaatatacagatgatttaattttaaaccgctgtctttttgccaaggtgctgcatgct
cccatcgccaacggcatcgtcacttccattgacacttccgaggccgaggctttggacggt
gttgtgaaagtcgtcacatttcatgaagttccaacacatacatatcccacgccgggccat
ccatggtctgtggagcagtcccatcaggatgtggcagaccgccatctgctgaccggaagg
atccgttactacggcgatgatattgccaccgttgtagcagaggatgaagtcacggcctca
agagccctgaagctgatcaaggcagaatatgaggagtatccgcctgttctgcatcccaga
gatgccatgaagggcagctctcctccggtccatgcagaaaacccggacaatatcctggca
aaaagcggctacgagatcggccatgtggaggaagctcttctggcatcggacatcgtcctg
aaggaatccttctgcacacctatggtccagcactgccatattgaagctcctatctcctac
gcctatatggaaaaagacaggatcgtggtggtcagttccacgcagatcccgcatatcgta
aaaagagtcatcgggcaggcccttggaatcccatggggaaaggtccgtgtcataaagcca
tatatcgggggaggttttggcaacaaacaggatgtcctgtacgaaccgctcaatgcattc
ctgacgacattggtgggcggccgcccggtgaagcttgacctttccagggaagagaccttc
gccaacacaaggacccggcattccattgagtacgatctgacagcaggtgtatccaaagag
ggaaagatcctagccaaggatatgaaggcctattccaatcagggggcctatgcctcccac
ggccatgccatcgcggcaaacggcgccaccgcatggcgccatatgtatgacgttaaaaat
atccgcgccgatgcttatacggtctacaccaacacacccgtaggcggagccatgcgcggc
tacggtattccccagttttgttttgtgtcagaatgcctgatggatgatatggcacacaag
ctttccatggatcctttgaagtttcgggaactcaacctatatgacggatactttgaagat
cctgttttgactcccattgcggcaaataccaacggcatcagggaatgtatgaggcgtggt
gctgattacatacactgggaagaaaaacgtgatttatataagaaccagaccggcgataaa
aggcgcggagtgggtatggccctgttcagctataaaacaggcgtatggcccatttctctg
gagatttctggcgccaggctgatcttaaaccaggacggcagtgtccagctccagaccggt
gcggcagagatcgggcagggttcagacacagtctttacacagatggcggcggatgtcctt
ggcctttgcccggaggacgttcacatccagtccttccaggatacggacatcactccgttt
gatacaggcgcctacgcttccagacagacatacatcagcggaaccgccgtaaaggaatgt
gccgaacttctgagagaaaagattctttcatatgccaggactttgatctctgaggaatat
aaagaccgggaactgaaattgtcagaaaaacagatctggtgcggcaaagaatcggtactg
tccctggaggaactggctttggagagctactacagccgctcctcctcttctgccatcacc
tccgacatctcccggcagatcaaaaagaataccatcgcgttcggtgcctgtttcgccgag
attgaggtggacttgaaactttcaaaaatcagaatccttgatattatcaacgtccacgac
agcggtaagatcatcaatccccagcttgcctccatgcaggtccacggcggtatgtccatg
gggattggttatggcctcagcgagcagatgctgctggatgaacaaactgggcgggtatta
aacgggaccctgctggattacaagcttcccactgccatggatgcccctgaccttcatctg
gattttgtggagcttgaggaccccaccggtccgtttggaaacaaagctctcggggagcct
cctgccattccccctgctccggccataagaaatgcatttctcaacgccacaggagtcgct
gtcaacgagatccccctctctccgcagagggtatttcaagaactaagaaaagccggactg
gtataa

DBGET integrated database retrieval system