KEGG   Anaerostipes rhamnosivorans: AR1Y2_2778
Entry
AR1Y2_2778        CDS       T05962                                 

Definition
(GenBank) Xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00230  Purine metabolism
arf01100  Metabolic pathways
arf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AR1Y2_2778
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: QCP36232
UniProt: A0A4P8IEF3
Position
2777683..2778168
AA seq 161 aa
MEPQKKLVTLTVNGREVAEYVDVRESLLELLRNHLGLTSVKKGCEVGECGACTVIVDGET
IDSCIYLAVWAQGKQIRTLEGLMGPNGELTKIQEAFIEEGAIQCGFCTPGFIMSATVLLE
RGEQELTRDMIRKYMAGNLCRCTGYENIINAVQKADKERHS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggaaccgcaaaaaaagcttgtaacccttacggtcaacggccgtgaagttgcagaatac
gtggatgtcagagaatccctgctggaactgctgagaaatcacctcgggctcacatctgtg
aaaaagggatgtgaggtgggagaatgcggtgcctgcacagtcatcgtggacggtgagacc
attgattcctgtatttatcttgccgtctgggcacagggaaaacagatccgcaccctggag
ggtcttatgggacccaacggtgaactcacaaaaatccaggaggcatttattgaggaaggc
gccatccagtgcggtttctgtaccccggggtttatcatgtctgccacggtacttctggaa
cgcggggaacaggaactgacccgggacatgatccggaaatatatggccggaaacctgtgc
cgctgcaccggttatgaaaatattattaacgctgtacagaaagctgataaggaacgtcac
tcttaa

DBGET integrated database retrieval system