KEGG   Anaerostipes rhamnosivorans: AR1Y2_3279Help
Entry
AR1Y2_3279        CDS       T05962                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00051  Fructose and mannose metabolism
arf01100  Metabolic pathways
arf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AR1Y2_3279
Enzymes [BR:arf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AR1Y2_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: QCP36733
Position
complement(3298487..3299143)
Genome map
AA seq 218 aa AA seqDB search
MRNRANEIKKEIVLYSKILDEKGLVNSLEGNLSIMDRESGLLYITPSGTRKRFLDEDMVA
VVKGQEQVGGSVKKSSEYLLHEAALKARPDCSAVAHLHAPYLTAYAYCNKTVRIKCSTTF
SLVFEEIPCLPYGEAGTVHIADGIEEAIKDHDLILLGNHGCVAVGKTLEDAVKIVEAAEE
VLKIYQLTKQIGQVEDIPDDKLESLYENHPGSRRNHYK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatagggcaaatgaaataaagaaggagatcgtactttactccaagatattagat
gaaaaagggctggtaaacagcctggaaggcaacctgtccatcatggacagagagtcaggc
ctgttatatattaccccgtccggaacgagaaaacgttttttagatgaggatatggtggct
gtggtaaaaggccaggagcaggtagggggaagtgtgaaaaaatccagtgagtacctgctg
catgaggcagcgctgaaggccagaccggattgcagtgctgtggcacatctccatgcgccg
tatctgacggcttatgcttactgtaataagaccgtcaggatcaagtgttccactacattt
tcacttgtatttgaggaaatcccatgcctgccctacggtgaggccggaaccgtacatatt
gcggacgggattgaggaggctataaaagaccatgacttgatcctgcttggcaaccatggc
tgtgtggcagtgggaaaaacactagaagatgcagtgaaaatagtggaggcagcagaagag
gtgttaaaaatttaccagttgacaaaacagattgggcaagtagaagatataccggatgac
aaactggaatcactgtatgaaaatcatccggggagcagacgaaaccattataaatag

DBGET integrated database retrieval system