KEGG   Anaerostipes rhamnosivorans: AR1Y2_3368Help
Entry
AR1Y2_3368        CDS       T05962                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00860  Porphyrin and chlorophyll metabolism
arf01100  Metabolic pathways
arf01110  Biosynthesis of secondary metabolites
arf01120  Microbial metabolism in diverse environments
Module
arf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AR1Y2_3368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arf01007]
    AR1Y2_3368
Enzymes [BR:arf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AR1Y2_3368
Amino acid related enzymes [BR:arf01007]
 Aminotransferase (transaminase)
  Class III
   AR1Y2_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QCP36822
UniProt: A0A4P8IFW8
Position
complement(3378941..3380203)
Genome map
AA seq 420 aa AA seqDB search
MEAYRYDKSFELYDRANEVVPCGLYGHLGVGRARLNPMGCYPLFSDHAEGTYIWDVDGNR
FIDYACAYGPNALGYQDPDVDAAALRQREKGNCTTVVSPVMIECAEKLVETLNCADWAFF
AKNGGDVTTLAVMTARHATGRKKIIMMEHGYHGVYQWCQKPGTPGVLDEEICNNLYVPFN
DFDAIEKMVKDHPGEIAGILSMPYDHISHYDNVLPKEDYWPKVRKLCDDHGIVLIIDDVR
AGFRMDLAGSDHYFGIKADLLTLGKAIANGWNMAALVGRKEMRDAVEDMNYTGSYWLSAV
PLAASVATLTKMKEIDATGIMRKTGEKLISGLKQVADANKVNLSTTGLPSLFKIILKDPD
ESMIPHQEWIGEMVRRGVYISHFHNMFTNTAMTDQDLQYTFDNADETLKMIIKKYPQILL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatatagatatgataaaagctttgagctatatgacagagcaaatgaagtagtt
ccatgcggcttgtacggacacctgggggtggggcgtgccaggctgaatcctatgggctgt
tacccgctgttctccgaccacgctgagggaacctatatctgggatgtggatgggaaccgt
tttatagattatgcttgtgcatatggaccaaatgcgctggggtaccaagatccggatgtg
gatgccgccgcgctgagacagagggaaaaagggaactgtaccaccgtggtttctccggtg
atgatcgaatgtgcggagaagctggtggagaccttaaactgcgcggactgggcgtttttt
gccaagaacggcggagatgtgaccactctggcggtgatgacggcccgtcatgccacaggc
aggaagaagatcatcatgatggagcacggatatcacggagtctatcaatggtgccagaaa
ccgggtactccgggagttctggatgaggaaatttgtaataatctttatgtaccgtttaat
gactttgatgccattgaaaagatggtaaaggatcatccaggagaaatcgcagggatcctg
tccatgccgtatgaccacatttctcactatgataatgtgctgccgaaggaggattattgg
ccgaaagtcagaaaactctgtgatgatcatggcatcgtgctgatcattgatgatgtgcgg
gcaggctttcgtatggatcttgcaggatctgaccattattttggaatcaaggccgatctt
ctgacgcttggtaaggccatagccaacggctggaatatggcagctctggttgggcgaaaa
gagatgagagatgcagtggaggatatgaattatacgggaagctattggctgtccgcggtt
cctttggcagcatctgtggccactctcacaaagatgaaagagatcgatgccacaggtatc
atgagaaaaacgggggaaaaacttatatccggcctgaaacaggtagctgatgccaacaag
gtaaatttaagcactaccggacttccgtctctgtttaaaatcattttgaaagatccagat
gaatctatgataccccatcaggagtggatcggtgagatggtgagaaggggagtttatatt
tcccatttccacaacatgtttacgaatacggcgatgacagaccaggatctgcagtatacc
tttgacaacgcagatgagactttaaagatgattataaagaaatatcctcaaattttgtta
taa

DBGET integrated database retrieval system