KEGG   Arthrobacter sp. Hiyo8: AHiyo8_09280Help
Entry
AHiyo8_09280      CDS       T04181                                 

Definition
(GenBank) levanase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AHiyo8_09280
Enzymes [BR:arh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     AHiyo8_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N BNR
Motif
Other DBs
NCBI-ProteinID: BAS12625
UniProt: A0A0K2RCS7
Position
612746..613297
Genome map
AA seq 183 aa AA seqDB search
MRPILHYTAKNTWLNDPNGLVWHQGVYHLFYQNNPFDNVWGNMSWGHATSTDLLHWTEHP
VAIACNEEEDVFSGSIVVDHGNTSGFGTAEEPALVAIYTSAFKEGSVHQGTQAQSLAFST
DAGMTWSKYAGNPVLGRGSAHFRDPRCSATRDRPVPAGSWWRWRPSTSRLCFTARPTSRT
GNT
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaatacttcactacacagccaagaacacgtggctgaacgaccccaacggactc
gtgtggcaccagggcgtctaccacctcttctaccaaaacaaccccttcgacaacgtctgg
ggcaacatgtcctggggacacgccacctcaaccgaccttctgcactggaccgaacacccg
gttgccatcgcctgcaacgaggaagaagacgtcttttccggcagcatcgtggtggaccac
ggcaatacgtcgggattcggcacagcagaagaaccggccttggtggccatctacacgagc
gccttcaaggaaggctcggtgcaccaagggacacaagcccagtctctcgcgttctcaacg
gacgccggcatgacctggagcaaatacgcaggcaaccccgtgcttggccgcggctcggcc
catttccgggacccaaggtgttccgctacgagggaccggccggttcccgctggatcatgg
tggcggtggaggcccagcaccagcaggttgtgctttaccgctcggccgacctcaaggact
gggaatacctga

DBGET integrated database retrieval system