KEGG   Arthrobacter sp. Hiyo8: AHiyo8_10600Help
Entry
AHiyo8_10600      CDS       T04181                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00260  Glycine, serine and threonine metabolism
arh01100  Metabolic pathways
arh01110  Biosynthesis of secondary metabolites
arh01120  Microbial metabolism in diverse environments
arh01130  Biosynthesis of antibiotics
arh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHiyo8_10600
Enzymes [BR:arh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AHiyo8_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAS12757
UniProt: A0A0K2RDS3
Position
706414..707526
Genome map
AA seq 370 aa AA seqDB search
MNEQVTSTTEEFPAALDTEAVGRLHDPSVRGFASDNYSGVHPEILAALAAANGGHQVSYG
EDQYTERLQEVMEEHFGAGIECFPVFNGTGANVLSLQSLLPRWGAVICASTAHINMDENG
APERIGGIKLLQVPTSDGKLTPELIDREAWGWGDEHRAQPLAVSITQTTELGTCYTPEEI
RAIADHIHAKGMKLHMDGARLANAAAHLGVPLRTFTRDAGVDILSFGGTKNGLLFGEVVV
ALNPEAAHGLKFLRKMNMQLASKMRFISVQFVALLESGLWLRSAEHANAMASRLRAAVDS
IEGVEPTQATESNGVFAVLPAGVADRLRSSFKFYDWNEANREVRWMCSFDTTEEDIDSFV
AAIKRELAAA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaacaagtgacgagcactacagaagaattcccggctgccctcgacacggaagcc
gttgggcgcctccacgatccctccgtccgcggtttcgcctcggacaactactcaggcgtc
caccctgaaatcctggcggccctggccgcagccaatggcggccaccaggtctcttacggg
gaggaccagtacacggagcggctccaggaagtcatggaggagcacttcggcgcaggcatc
gaatgcttccccgtcttcaacgggactggcgcgaacgtgttgtccctgcagtcgctgctg
ccgcgctggggtgcggtcatctgcgcatcgaccgcccacatcaacatggacgagaacggc
gcaccggagcggatcggcggcatcaagcttctccaggtcccgacgtcggacggcaagctg
accccggaattgatcgaccgcgaagcgtggggctggggcgacgaacaccgcgcgcagccc
ctggccgtctccatcacgcagaccacggagctcggcacgtgctacacgccggaagaaatc
cgggcgatcgccgaccacatccatgccaagggcatgaaactgcacatggacggcgcccgg
ctcgccaatgctgccgcccaccttggcgtgcccttgcggacgttcacccgcgacgccggc
gtcgacatcttgtccttcggcggcaccaagaacgggctgctgttcggcgaagtggtggtc
gccctgaatcccgaggccgcccacgggctgaagttcctgcgcaagatgaacatgcagctg
gcctccaagatgcgcttcatctcggtccagttcgtcgcgcttctggagtccgggctgtgg
cttcgctcagcggaacacgcgaatgccatggcctcacggctgcgtgcggcggtcgactcc
atcgagggcgtggagcctacccaggccacggagtccaacggcgtcttcgcggtactgccc
gccggcgtcgccgatcgcctccgctcctccttcaagttctacgactggaacgaagcgaac
cgggaggtgcgctggatgtgttccttcgacaccaccgaagaggacatcgattccttcgtt
gccgcaatcaagcgcgaactggccgcggcatag

DBGET integrated database retrieval system