KEGG   Arthrobacter sp. Hiyo8: AHiyo8_17750Help
Entry
AHiyo8_17750      CDS       T04181                                 

Definition
(GenBank) mycothiol S-conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
arh  Arthrobacter sp. Hiyo8
Brite
KEGG Orthology (KO) [BR:arh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AHiyo8_17750
Enzymes [BR:arh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     AHiyo8_17750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: BAS13472
UniProt: A0A0K2RFR5
Position
complement(1242557..1242877)
Genome map
AA seq 106 aa AA seqDB search
MAMYAASGVEVMVATCTDGSRGDIQNPAMESAPHPKRDMAGARRLEMKQAAAVLGIKQRW
LGFVDSGLPDGDPLPPLPAGCFALQPLSGPRHRSSAWSATSSRTSW
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtatgcggcttccggcgtggaggtcatggtggctacctgcaccgacggttcc
cgcggggacatccagaacccggccatggagtccgccccgcacccgaagcgcgacatggca
ggcgcgcgccgtttggaaatgaagcaagctgccgcggtccttggaatcaagcagcgttgg
ttgggcttcgtggattccggactgcccgacggcgatccgttgccacccctgcccgccggc
tgctttgcgcttcagcccttgagcgggcctcggcaccgctcgtccgcttggtccgcgact
tcaagccgcacgtcatggtga

DBGET integrated database retrieval system