KEGG   Arthrobacter sp. Hiyo8: AHiyo8_29140Help
Entry
AHiyo8_29140      CDS       T04181                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00480  Glutathione metabolism
arh00590  Arachidonic acid metabolism
arh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AHiyo8_29140
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AHiyo8_29140
Enzymes [BR:arh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AHiyo8_29140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAS14611
UniProt: A0A0K2RIF8
Position
complement(2062806..2063042)
Genome map
AA seq 78 aa AA seqDB search
MASKCGFTRQYSGLEELYGKYRDRGFEILGVPCNQFAGQEQGSDAEIADFCQRNFGVSFP
LASKAKVRGKQQHPCTPS
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
gtggcttcgaagtgtgggttcacgcgccagtactcgggactggaggagctctacggcaaa
taccgtgaccgtggattcgagattctgggcgtgccgtgcaaccagttcgccggccaggaa
cagggttcggacgccgagatcgcggacttctgccagcgcaatttcggcgtctcgttcccg
ctcgcgagcaaggccaaggtccgcggcaagcaacagcacccctgtacgccgagctga

DBGET integrated database retrieval system