KEGG   Arthrobacter sp. Hiyo8: AHiyo8_47660Help
Entry
AHiyo8_47660      CDS       T04181                                 

Definition
(GenBank) o-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00130  Ubiquinone and other terpenoid-quinone biosynthesis
arh01100  Metabolic pathways
arh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AHiyo8_47660
Enzymes [BR:arh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     AHiyo8_47660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_like_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: BAS16463
UniProt: A0A0K2RNP9
Position
3418937..3419515
Genome map
AA seq 192 aa AA seqDB search
MRVKFRGITERETLLFRGPAGWGEFCPFPEYGDAEAARWLAAAVEAAWQGFPPPLRDTIP
VNATVPAVPAARVPEVLERFGRVNAVKVKVAERGQELADDVARVTAVRDALPDAAIRVDA
NAGWDVPQAVEALGRLSAVGLEYAEQPVPQIEGLAEVRRRLVQQGTPVLIAADESVRKED
DPSRWPARARRT
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcaagttccggggcatcaccgagcgcgagaccctcctgttccgcggaccggcc
ggatggggcgaattttgtccgttccctgagtacggcgacgccgaggccgcgcgctggctc
gccgccgccgtcgaagccgcatggcagggttttccgccgccgctgagggacaccattccc
gtcaacgcgaccgtccccgccgtgccggccgcccgggtgccagaggtcctggagcgcttc
ggacgcgtgaacgccgtcaaggtcaaggtcgccgagcgcggtcaggaactggccgacgac
gtcgcgcgcgtcaccgcagtccgcgacgccctgccggacgccgcgatccgggtggacgcg
aacgcaggctgggacgtgccgcaggcggtggaggcacttgggcggctatccgccgtcggg
ctcgagtatgccgagcagcccgtgccgcagatcgagggccttgccgaagtccgccggcgg
ctcgtgcagcagggcacccccgtgctcatcgccgccgacgaatccgtgcgcaaggaagac
gatccctcaaggtggcccgcgcgggcgcggcggacctga

DBGET integrated database retrieval system