KEGG   Arthrobacter sp. Hiyo8: AHiyo8_56980Help
Entry
AHiyo8_56980      CDS       T04181                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
arh00471  D-Glutamine and D-glutamate metabolism
arh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AHiyo8_56980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arh01011]
    AHiyo8_56980
Enzymes [BR:arh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AHiyo8_56980
Peptidoglycan biosynthesis and degradation proteins [BR:arh01011]
 Precursor biosynthesis
  Racemase
   AHiyo8_56980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BAS17395
UniProt: A0A0K2RRD7
Position
4084440..4085132
Genome map
AA seq 230 aa AA seqDB search
MNSASDAVSDGESAAAALESQRTPETLNSTAPNPLLGSRPIGVFDSGVGGLTVARSIIDQ
LPHESIIYVGDTANGPYGPLPIAEVRANALGVMDELVDSGVKLLTIACNSASAAVLRDAR
ERYTARYGIPVIEVIQPAVRRAVAATRSGRIGVIGTSATVGSRAYEDTFAAAPDLSITSV
ACPEFVSFVEAGITTGPSCWPRPTNTWNRSGKPAWTPWCSAARTIPCLLA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagcatcggacgcggtatcggatggggagagcgccgcagcggcgttggaatcc
cagcgcacgccggaaacactgaacagcacagcacccaaccccttgctgggatcacgcccc
atcggtgtcttcgattccggagtcggcggactcaccgtggcacggtccatcatcgaccaa
ttgccccatgagtcgatcatctacgtgggagacacagccaacggaccctacgggccgctc
cccatcgccgaagtccgggccaatgccctcggcgtcatggacgagctcgtggactccggc
gtgaaactcctgaccatcgcctgcaactcagcctcggccgccgtcttgcgcgatgcccgc
gaacgctacacggcccgctacgggattcccgtcatcgaggtcattcaacccgcagtccgc
cgggcggtggccgcgacgagatccggcaggatcggcgtgatcgggacatcggccacagtg
ggttcccgcgcttacgaggacacctttgccgcagccccggacctcagcatcacctcggta
gcctgccccgaattcgtgagtttcgtggaggccggcattacgaccggcccgagctgctgg
ccgcggcccacgaatacctggaaccgctcagggaagccggcgtggacaccgtggtgctcg
gctgcacgcactatcccttgcttactggcgtga

DBGET integrated database retrieval system