KEGG   Psychromicrobium lacuslunae: UM93_05490Help
Entry
UM93_05490        CDS       T03775                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ari  Psychromicrobium lacuslunae
Pathway
ari00670  One carbon pool by folate
ari01100  Metabolic pathways
ari01120  Microbial metabolism in diverse environments
ari01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ari00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    UM93_05490
Enzymes [BR:ari01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     UM93_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AJT41107
UniProt: A0A0D4BXE1
Position
complement(1187833..1188837)
Genome map
AA seq 334 aa AA seqDB search
MSPPSILVDPLEKISAQHRAPVALSYELFPPRTPAAVDGLWTTIRELESTNPDYVSVTYG
ASGSNRDTAVELLHNLLSQTTLRPLAHLTCIGNTADELAGIITELLDAGVRGILALRGDH
PNDGTEEHPAGALNFAQDLVELIRRVEQRRSAMLAAGKVAIGVAAYPTTHPESPSQQHDI
EVLLAKQRSGADFAITQVFFHPEQYAELVLKARRAGVSIPIIPGVMPFTSLRRLQRLAEL
TGVQPDERLLAALASAGDDAERRRIGVSATTELAKAVLDVGAPGIHLYTFNQHQAALEVL
DRLDLVRPSAPTSKKRQLGAKTTLDSHSNLGSSH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccccacccagtattcttgttgaccccctcgaaaaaatctcagcccagcaccgggca
ccggttgcgctctcctacgagctatttccaccccgtacgccagcggctgtcgatggcctc
tggaccacaatccgtgaattggagagcaccaatccggattacgtctcggtcacctatggt
gccagcggatcaaaccgggacaccgccgtggaactgcttcacaacctgctcagccagacc
acgctaaggccgctggcacatctgacctgcatcggcaacaccgccgatgaattagctggc
atcatcaccgagttgctagatgccggtgtacgcggcatcttggcgctccgcggtgatcat
ccgaacgatggcaccgaggagcatccggccggggcgctgaactttgcccaggacctggtg
gagctaattcgtcgagtggaacaacgtcgatcagcgatgctggcggcggggaaagtggcc
attggagtagcggcgtacccgaccacccatccggagtcacccagtcagcagcacgatatt
gaggttttgctggccaagcagcgctcgggggctgacttcgctatcacccaggtctttttc
cacccggaacaatacgccgaattggttctcaaagcgcgccgggctggcgtgagcatcccg
atcatccccggggtgatgccgtttacttcgctcagacgacttcaacgactggccgaactt
accggcgtccaaccggatgagcgattacttgctgcgctagcctcggctggcgacgacgcc
gaacgccgtcggatcggcgtcagcgctaccaccgagctcgccaaggcggtgctggacgtc
ggcgcgccgggaattcacctctacaccttcaaccagcatcaagccgcgcttgaggtgctg
gaccgccttgacttagtcaggccctcagcgccaacttccaaaaaacggcagctcggcgca
aaaaccaccctagactcccattccaatctcggctcttcgcactaa

DBGET integrated database retrieval system