KEGG   Psychromicrobium lacuslunae: UM93_15635Help
Entry
UM93_15635        CDS       T03775                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ari  Psychromicrobium lacuslunae
Pathway
ari00480  Glutathione metabolism
ari00590  Arachidonic acid metabolism
ari01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ari00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    UM93_15635
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UM93_15635
Enzymes [BR:ari01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UM93_15635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJT42558
UniProt: A0A0D4C1V5
Position
3308376..3308876
Genome map
AA seq 166 aa AA seqDB search
MTGSEASLYSIPLTLNDGTETDFGRFQGKTVMVVNVASQCGFTPQYAGLEALYEKYRAQG
FEVLGVPCNQFAGQEPGTDEDIQEFCSRNFGVTFTLSKKADVRGKDQHPLYAELTKFKNG
ILPGLIKWNFEKFLISSEGKVVARFAPNVEPDAEEITSAIERELAA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctgaggcatcgctctacagcatcccgctaaccctcaacgacggcaccgag
accgactttggccgcttccagggcaagacagtaatggtggtgaatgtcgcctctcagtgt
ggcttcactccgcagtacgccgggcttgaggcgctctatgaaaagtatcgggctcagggc
tttgaagtacttggcgtgccctgtaatcagttcgccggtcaggaacccggcaccgacgag
gatatccaggaattctgcagccggaacttcggcgtaaccttcaccctgagtaaaaaagca
gatgtccgaggcaaggaccaacacccgctctatgccgaattgaccaagttcaagaacggc
atcctgcccggtctgatcaagtggaactttgagaagttcctgatcagctctgaaggcaaa
gttgtggcacgtttcgcccccaatgttgagccggacgccgaagaaatcactagcgccatc
gaacgggaacttgccgcctga

DBGET integrated database retrieval system