KEGG   Arachidicoccus sp. KIS59-12: D6B99_01815Help
Entry
D6B99_01815       CDS       T05648                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ark  Arachidicoccus sp. KIS59-12
Pathway
ark00511  Other glycan degradation
ark00600  Sphingolipid metabolism
ark01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ark00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    D6B99_01815
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D6B99_01815
Enzymes [BR:ark01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     D6B99_01815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AYD46460
UniProt: A0A386HLR0
Position
405105..406559
Genome map
AA seq 484 aa AA seqDB search
MHHQKNIFCYCFLTLCLISCAKKEVLSQSNKESNQTTTPPKNYEDIDVWLTQGDKSFLFK
ERKNVVIFNNVANQNATIEVDSTKKYQQIDGFGFCLTDGSAYLMNKMSSDSKAKLLKELF
ATDSSNIGISYIRVSIGASDLSSNVYTYDDMSNGQTDSTLTNFSIAEAKTDLIPILKQIL
AINPNIKILGSPWSAPSWMKDNNNSKGGSLLSKYYYSYANYFVKYIQSMQAAGIKIDAIT
PQNEPLNPNNNPSMYMTAKDEADFIKNALGPAFANAGITTKIIVYDHNCDVPQYPLTILN
DADAAQYVDGSAFHLYAGDISALSTLHNSFPNKNVYFTEQYTPSSGSFSGDLSWAINNLI
VGATQNWSKNVLEWNLASDPNLEPHTPGGCNTCLGAITIDGDLVTRNQSYYIIAHASKFV
RPGSYRILSSNIANISSVAFLTPDGRKVLIALNTSNASQTFNIKYKGNIAQTSLNPGAVA
TYVW
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatcaaaaaaatattttttgctattgctttcttacactttgtttaatttcatgt
gctaagaaagaagtgctttctcaatctaataaggaaagcaatcagacaaccaccccacca
aaaaattatgaagatatagatgtatggcttacgcagggagataaatcatttttatttaaa
gaaagaaaaaatgtagtaatctttaataatgtggcaaaccagaatgcgactattgaagtg
gactctacaaaaaagtaccaacaaattgatggctttggattttgccttaccgatggaagt
gcttacttaatgaataaaatgtcttcggatagtaaagctaaattattaaaagaattgttc
gctactgacagtagtaatattggcatcagttatataagagttagtatcggtgcatcagat
ttaagcagcaatgtttatacttatgacgatatgtctaatgggcaaacagattcgactctc
acaaattttagtattgccgaggcaaaaactgatttaattcctattttaaaacaaatattg
gccatcaatcccaacataaaaatacttggttcgccatggtctgctccatcctggatgaag
gataataacaattcaaaaggaggcagtctattgtcaaagtattattattcctatgcaaat
tattttgtaaaatatatacaatctatgcaagcagcaggcataaaaatagatgccattaca
ccgcaaaacgaaccattaaaccccaacaataatccaagcatgtatatgactgcaaaagat
gaagcagactttattaaaaatgccttaggacctgcttttgccaatgctggaattaccaca
aaaattattgtgtatgaccacaattgcgatgtgccgcaatatcctttaactattttaaat
gatgccgatgcagctcaatatgttgacggctctgcattccatttgtatgctggagatatt
tcagcactttctacattacataattctttccccaataaaaatgtttatttcacagaacaa
tacactccttcctctggctcatttagcggcgacctttcttgggcaatcaacaatttaatt
gtaggtgctacgcaaaactggagtaagaacgttttggaatggaacttggcatcagaccca
aatttagaacctcatacacctggtggttgcaatacttgtttaggcgccattaccattgat
ggtgatttggtaacacgcaatcaatcttattatattattgcacacgcatcaaaatttgtg
agaccaggttcttacagaattttgtctagcaacattgctaatatttcaagcgtagcattt
cttacacctgatggaagaaaggttttaattgccttgaacacaagcaatgcatcacaaacc
tttaatatcaaatacaagggcaatatcgcccaaaccagtttaaacccaggcgccgtagcc
acttatgtgtggtaa

DBGET integrated database retrieval system