KEGG   Arachidicoccus sp. KIS59-12: D6B99_09145Help
Entry
D6B99_09145       CDS       T05648                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ark  Arachidicoccus sp. KIS59-12
Pathway
ark00040  Pentose and glucuronate interconversions
ark00053  Ascorbate and aldarate metabolism
ark01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ark00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D6B99_09145
   00053 Ascorbate and aldarate metabolism
    D6B99_09145
Enzymes [BR:ark01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     D6B99_09145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYD47740
UniProt: A0A386HQH5
Position
complement(2145646..2147118)
Genome map
AA seq 490 aa AA seqDB search
MNENKEGKLADEVMHNALMAFEKYSLIDKKSKAGFLKEIAKQIELNRIELIPLAIEESHL
SEARLQGELTRTINQLNLFATLLLEGSWVDASIDIGNAQQKPYPKPDVRKMLQPMGPIIV
FGASNFPFAFSTAGGDTASALAAGASVVIKAHPAHYRTSSAIFKAIKTAIAFSNMPEFTV
QHVEGSFALGKALVQHSFTSGVGFTGSFSGGKALMNYAAEREKPIPVFAEMSSINPTVLY
PDYLKTNYLQVAEKLASSITLGAGQFCTNPGLLLALDGDELDGFIEELRNKMQSIPAQKM
LHEGIYKNYIEAIGQVKRNNDVEIIFEGNDLSSEMDVLPFIAKVKAAVFLDKNHLKDEIF
GPYSLLVVCKNKEELKSVLKLIAGQLTTTLMATEKDMNQHSDILHIQQSIAGRIIVNDVP
TGVEVCSSMVHGGPYPATSDARYTSVGTAAIKRWVRPVCYQGFPQQHLPDELKNDNPLKI
WRLENNEWKK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaataaagaagggaaacttgcagatgaagtcatgcataacgcattgatggca
tttgaaaaatattcccttattgataaaaaatccaaggctggtttcctaaaagagatagca
aagcagatagaactaaataggatagaactaattccactagcaatagaagaaagtcatttg
tcggaggcaaggttacagggtgaactaacaagaacaatcaaccagttaaatttattcgca
actttattgttggaaggcagttgggtggatgcctccattgacattggtaacgcacaacaa
aaaccgtatcccaaacccgatgttcgtaaaatgctgcaacctatgggacctattattgtt
tttggcgctagcaattttcccttcgcattttctacagcaggtggagatacggcaagtgcc
ttggctgcaggagcgagtgttgttataaaagcgcatcctgcacactatagaacatcgagc
gccatatttaaagccataaaaactgcgattgctttttctaatatgcctgagttcactgta
caacacgttgagggttccttcgcattgggtaaagcattagtgcaacattcattcacaagt
ggtgtaggatttacgggttctttttctggtggaaaggctttgatgaattatgcagccgaa
agagaaaaaccaattccagtttttgcagaaatgagcagtatcaatccgactgtgttatat
ccagactatttgaaaacaaactatttacaagtagcagagaaattggcatcttctattaca
ctaggtgcagggcaattttgtactaaccctggtttattgctcgccctagatggggatgag
cttgatgggtttatagaagaattaagaaataaaatgcaatctattcctgctcaaaagatg
ctgcacgagggtatttataaaaattatattgaagctattggtcaggttaaacggaacaat
gatgtggaaattatttttgaaggaaacgatctgtccagtgaaatggatgtcttgcctttc
atcgcaaaagtgaaagcagcggtgttcttagataaaaatcatcttaaagatgaaatattt
ggaccttattcattattggttgtatgcaaaaataaagaggaattgaaatcagtattaaaa
ttgattgctggtcaattgacaactacattaatggcaacagaaaaagatatgaatcagcat
agcgatatcttacatattcaacaatcaattgcaggaaggattattgtaaatgatgttcca
actggcgtggaagtgtgtagtagcatggtgcatggtggtccttatccggctacttcggat
gcacgatatacttctgtaggaactgcagctatcaaacgctgggtaagacctgtttgttat
caaggctttccacaacaacatttacctgatgaattgaaaaatgataatcccttgaaaata
tggcggcttgaaaataatgaatggaaaaaataa

DBGET integrated database retrieval system