KEGG   Arachidicoccus sp. KIS59-12: D6B99_15235Help
Entry
D6B99_15235       CDS       T05648                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ark  Arachidicoccus sp. KIS59-12
Pathway
ark00471  D-Glutamine and D-glutamate metabolism
ark00550  Peptidoglycan biosynthesis
ark01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ark00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D6B99_15235 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D6B99_15235 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ark01011]
    D6B99_15235 (murD)
Enzymes [BR:ark01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     D6B99_15235 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:ark01011]
 Precursor biosynthesis
  Amino acid ligase
   D6B99_15235 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C DUF4909 3HCDH_N HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AYD48844
UniProt: A0A386HU57
Position
3637986..3639350
Genome map
AA seq 454 aa AA seqDB search
MNKNSSNTKQLMCILGAGESGVGAALLAQRNGYEVFVSDSGKIAEKYIKELEDNKIEFEE
GQHSEEKVLSASEVMKSPGIPEKNTLIKKIRAKNIPIISEIELAYRYKGNSKIVAITGTN
GKSTTTSLIYHICTTAGLDCALVGNIGYSFAKQVAENPKALYVAEISSFQLDDIVTFRPD
IAVLLNITEDHLDRYAYNIENYINSKFRIIENQTVNDYFIYCLDDELIMTHLKHITISSN
PLPFSMKQEVNKGAYIKDNQMMIKAQEERISMNIYDFVALKGKHNQYNTMAAGIAASVLD
IRKEKIREAVQTFESLEHRMEFVATIRGVEFINDSKGTNLNSVWFALESMTKPTILIMGG
VDKGNDYTLIEDLIKEKVKAIVCLGLDNKKIHEAFSGKINTIVDTQSMKDAVTEAYKLAE
KEDTVLLSPGCSSFDLFKNYMDRGDQFKVEVKNL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaattcttcaaatacaaagcagttaatgtgcatacttggtgccggggaaagc
ggcgtaggcgcagcattattagcgcagcggaatggttacgaggtttttgtaagtgactcg
gggaaaattgctgaaaaatatataaaagaattagaagacaataaaattgaatttgaagaa
ggacaacattctgaagaaaaagtattatcagccagcgaagtaatgaaaagcccgggtatc
ccggaaaaaaatacattgataaaaaagataagagcgaaaaacatcccgattattagtgaa
atagaattggcttatcgctacaaaggaaatagtaaaattgttgctatcaccggaaccaat
ggcaagagtacgaccacatcattgatttatcatatttgtacaactgccggattggattgt
gcgctcgtaggaaatattggctattcatttgcaaagcaagttgccgaaaacccgaaagca
ctttatgtagcagaaattagttcttttcagttggatgatattgtaacatttcgacctgac
atagcagtcttactcaatattacagaagatcatcttgacaggtatgcatacaatattgaa
aattatataaacagtaaattcagaataatagaaaatcaaacagtcaatgattactttatt
tattgtctcgacgacgaattaatcatgactcatttaaaacatattactatctcatctaac
ccattacctttttctatgaaacaagaagtaaacaaaggcgcttacattaaagacaatcaa
atgatgattaaagcacaggaagagcgcataagcatgaacatttatgatttcgtggcattg
aaaggtaaacacaatcaatacaacacaatggccgcaggcatagcagcgtcggtattagac
attcgtaaagagaaaattcgcgaggcggtacaaacatttgaaagccttgaacatcgcatg
gaatttgtagccaccatacgtggtgtagaatttatcaatgatagcaaaggcaccaatctt
aactcagtatggtttgcattggaaagtatgacaaaacctactattcttattatgggcggc
gtagataagggcaacgactatactttaatcgaagatttgattaaagagaaagtaaaagct
attgtttgcttaggtctagataataaaaaaattcacgaagcatttagcgggaaaatcaat
acaatcgttgacacacagtctatgaaagatgctgtaacagaagcctataagctggcagag
aaagaggataccgttttattaagcccgggttgttcgagcttcgacttatttaaaaattac
atggacagaggcgatcaatttaaagtagaagtaaaaaacttatag

DBGET integrated database retrieval system