KEGG   Arthrobacter sp. LS16: AFL94_02400Help
Entry
AFL94_02400       CDS       T04078                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00240  Pyrimidine metabolism
arl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AFL94_02400
Enzymes [BR:arl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     AFL94_02400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_22 AAA_28 PPK2 AAA_16 T2SSE AAA_17
Motif
Other DBs
NCBI-ProteinID: ALD62990
Position
complement(516638..517291)
Genome map
AA seq 217 aa AA seqDB search
MSIDSSAPARGLFIVFEGGDGAGKSTQVQRTSQWLRERNATVLTTREPGGTQISEELRAL
VLEHGHGEIDARTEALMYAAARAAHVQQVIIPALEAGTHVVCDRFVDSSLAYQGVGRELG
VEAVASINNFATGGLAPDATILLDISAADGRSRRIAGTGGVEESDRLESEPDAFHNRIRT
AFADLAAKSPERYLVLDANQGIEQLQAQITARLEDLL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcgattcgtccgcccctgcccgcggcctgttcattgtctttgaaggcggcgac
ggcgccggcaagtccacccaggtccagcgcaccagccagtggctgcgggaacgcaacgcc
accgtgctgaccacccgcgaaccgggcggcacgcagatcagcgaggagctgcgcgccctg
gtgctggagcacgggcacggagagatcgacgcccgaaccgaggccctgatgtacgccgcg
gcccgcgcggcccacgtccagcaggtcatcatcccggcgctggaagccggcacccacgtg
gtctgcgaccgttttgtcgattcctccctggcctaccagggcgtggggcgcgagctcggc
gtggaggctgtcgcgtccatcaacaatttcgccaccggcggcctggccccggacgccacc
atcctgctggacatctccgcggccgacggccgttcccggcgcatcgccggcaccggcggc
gtcgaggaatcggaccggctggaatccgagccggatgccttccacaaccgcatccgcacc
gccttcgcggacctggccgccaagtcgccggaacgctacctggtgctcgacgccaaccag
ggcatcgagcagctgcaggcgcagatcaccgcgcgtctggaggacctgctgtga

DBGET integrated database retrieval system