KEGG   Arthrobacter sp. LS16: AFL94_09015Help
Entry
AFL94_09015       CDS       T04078                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:arl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFL94_09015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arl01007]
    AFL94_09015
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:arl03016]
    AFL94_09015
   03029 Mitochondrial biogenesis [BR:arl03029]
    AFL94_09015
Enzymes [BR:arl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AFL94_09015
Amino acid related enzymes [BR:arl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AFL94_09015
Transfer RNA biogenesis [BR:arl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AFL94_09015
 Prokaryotic type
   Other AARSs
    AFL94_09015
Mitochondrial biogenesis [BR:arl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AFL94_09015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ALD64037
Position
complement(1970938..1972740)
Genome map
AA seq 600 aa AA seqDB search
MLRTHQLGVLNAEHIGQQVTLTGWVARRRDHGGVAFLDLRDASGVAQVVVRDEEDFHPLR
NEFVLQIKGTVERRPEGNENPNLPTGEIEVIADEVIVLNTAAPLPFQVDEHVEVGEEARL
RHRYLDLRRPTPTRNLRLRSEVNRVARNLLHDEGFVEIETPTLTRSTPEGARDFVVPARL
SPGSWYALPQSPQLFKQLLQVGGFEKYYQIARCYRDEDFRADRQPEFTQLDIEASFVEED
DIIALGEKLVKAIWALIDVEIPTPIRRMTYAEAMEKYGSDKPDLRFGLELTEMTEYFANT
SFKVFQSAYVGAVVMPGGASQPRRTLDAWQEFAKQRGAKGLAYVLLKEDGELAGPVAKNL
SDEEKAGLAAATGAKPGDCIFFSAGDKAESRALLGSVRVEIGHRTGLIKDGDWAFVWVVD
APMFEPASAAVASGDVAVGAGAWTAVHHAFTSPKPEFLDTFDTDPASALSYAYDIVCNGN
EIGGGSIRIHQRDVQERVFKLMGVSEEQAQTQFGFLLEGFKFGAPPHGGIALGWDRVLQL
LTGSESIRDVIAFPKTGGGFDPLTQAPAPITAQQRKEAGIDFKPEKKKADAESKAEAEAK
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgctacgcactcatcagctgggcgtgctaaacgccgagcacattggacagcaggtcacc
ctcaccggctgggtcgcccgccgccgtgaccacggtggagtggcgttcctggatctgcgc
gacgcctcgggcgtggcccaggtcgtggtgcgcgacgaggaggacttccacccgctgcgc
aatgagttcgtgctgcagatcaagggcaccgtcgagcgccgcccggaaggcaacgagaac
ccgaacctgcccaccggcgaaatcgaggtgatcgccgacgaggtgatcgtgctgaacacc
gccgcgccgctgccgttccaggttgatgagcacgtcgaggtcggcgaggaggcgcgcctg
cgccaccgctaccttgacctgcgccgcccgaccccgacccgcaacctgcgcctgcgttcc
gaggtcaaccgcgtggcccgcaacctgctgcacgacgaaggcttcgtggagatcgagacc
ccgacgctgacccgctccaccccggaaggcgcccgcgacttcgtcgttcccgcccgcctg
tccccgggcagctggtacgcgctgccgcagtccccgcagctgttcaagcagctgctgcag
gtcggcggcttcgagaagtactaccagatcgcgcgctgctaccgcgacgaagacttccgc
gccgaccgccagccggagttcacccagctggacatcgaggcctcgttcgtcgaggaagac
gacatcatcgccctgggcgagaagctggtcaaagccatctgggcgctgatcgacgttgag
atcccgaccccgatccgccgcatgacctacgccgaggccatggagaagtacggttcggac
aagccggacctgcgcttcggcctcgagctgaccgagatgaccgagtacttcgcgaacacc
tccttcaaggtgttccagtcggcctacgtcggcgccgtggtcatgcccggcggcgcctcg
cagccccgccgcaccctggatgcctggcaggaattcgccaagcagcgcggcgcgaagggc
cttgcctacgtgctgctcaaggaagacggcgagctggccggcccggtggccaagaacctc
tccgatgaggagaaggcgggcctggccgccgccaccggcgccaagccgggggactgcatc
ttcttctccgccggcgacaaagccgaatcccgcgccctgctcggctcggtccgcgtggag
atcggccaccgcaccggattgatcaaggacggcgactgggccttcgtgtgggttgttgac
gcaccgatgttcgaacctgcctccgccgcggtcgcctcgggcgacgtggcagtgggcgcc
ggcgcctggaccgctgtgcaccacgcgttcaccagcccgaagccagagttcctggacacc
ttcgacaccgaccctgcctcggccctgtcctacgcgtacgacatcgtctgcaacggcaac
gaaatcggcggcggctcgatccgtatccaccagcgcgacgtgcaggagcgcgtcttcaag
ctgatgggcgtgagcgaggagcaggcgcagacccagttcggcttcctgctcgagggcttc
aagttcggcgccccgccgcatggcggcatcgccctgggctgggaccgcgtgctgcagctg
ctcaccggttcggagtccatccgcgacgtcatcgccttcccgaagaccggcggcggcttc
gacccgctgacccaagctccggcgccgatcaccgcgcagcagcgcaaggaggccggcatc
gacttcaagcccgagaagaagaaggccgacgccgagtcgaaggctgaggcagaagccaaa
tag

DBGET integrated database retrieval system