KEGG   Arthrobacter sp. LS16: AFL94_09975Help
Entry
AFL94_09975       CDS       T04078                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
arl  Arthrobacter sp. LS16
Pathway
arl00030  Pentose phosphate pathway
arl00480  Glutathione metabolism
arl01100  Metabolic pathways
arl01110  Biosynthesis of secondary metabolites
arl01120  Microbial metabolism in diverse environments
arl01130  Biosynthesis of antibiotics
arl01200  Carbon metabolism
Module
arl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
arl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:arl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFL94_09975
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFL94_09975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:arl04147]
    AFL94_09975
Enzymes [BR:arl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AFL94_09975
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AFL94_09975
Exosome [BR:arl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFL94_09975
  Exosomal proteins of colorectal cancer cells
   AFL94_09975
  Exosomal proteins of bladder cancer cells
   AFL94_09975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ALD64192
Position
2169404..2170924
Genome map
AA seq 506 aa AA seqDB search
MSNPLRDARDRRLNRIAGPGALVFFGITGDLARKKLMPAVYDLASRGLLPPNFAIVGFGR
RDWSAQDFAAQAREWILASSRTPFNETVFAQLASGMRFISGAFDDDDAYEQLSATLDELA
ETRSTGRNHAFYLSIPPSWFDVVCEKLSEHKLANDANEGWERVVIEKPFGHDLASARELN
EIVESVFPPDAVFRIDHYLGKETVQNLLALRFGNQMFEPLWNNKYVDHVQITMAEDIGIG
GRASYYDGVGAARDVIQNHLLQLLALTAMEEPISFDADHLRSEKEKVLAAVKLPQDLGAA
SARGQYTSGWQGGEEVVGFLDEEGFNPKSKTETYAAIRLNINTRRWDGVPFYLRAGKRLG
RRVTEIAVVFKKAPNLLFTDHKDDEFGQNAFVIRVQPDEGATIRFSSKVPGTQMEIRDVT
MDFGYGNAFTESSPEAYERLILDVLLGEPPLFPRHEEVEQSWRILDPFEEYWAAQPEQPD
PYAPGSWGPASSDELMAKDGRTWRRP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccactacgcgacgcccgcgaccggcggcttaaccgcatcgccggtccgggc
gcgctggtgttcttcggaatcaccggcgaccttgcccgcaagaagctgatgccggcggtc
tacgacctcgccagccgcggcctgctgcccccgaacttcgccatcgtcggcttcggccgc
cgcgactggtccgcgcaggacttcgccgcccaggcgcgcgaatggatcctggccagctcc
cgcaccccgttcaacgagacggtgttcgcgcagctggcctccggcatgcgcttcatctcc
ggcgccttcgacgacgacgacgcctacgagcagctctccgccaccctggacgagctggca
gagacccgctccaccggacgcaaccacgcgttctacctgtccatcccgcccagctggttc
gacgtggtctgcgaaaagctctccgagcacaagctggccaacgacgccaacgagggctgg
gagcgcgtggtcatcgagaagcccttcggccacgacctggccagcgcgcgcgagctgaac
gagatcgtcgagtcggtgttcccgccggacgccgtatttcgcatcgaccactacctgggc
aaggagacggtgcagaacctgctggcgctgcgcttcggcaaccagatgttcgagcctttg
tggaacaacaagtacgtggaccacgtgcagatcaccatggccgaggacatcggcatcggc
gggcgcgcgagctactacgacggcgtgggcgcggcccgcgacgtgatccagaaccacctg
ttgcagctgctggcgctgaccgccatggaggagcccatcagcttcgacgcggaccacctg
cgcagcgagaaggaaaaggtgctcgcagcggtcaagctgccgcaggacctgggcgcggct
tcggcgcgcggccagtacacctccggctggcagggcggcgaggaggttgtcggcttcctt
gacgaggagggcttcaatcccaagtccaagaccgagacctacgcggcgatcaggctgaac
atcaacacccgccgctgggacggggtgccgttctacctgcgcgccggcaagcgcctggga
cggcgcgtcaccgagatcgcggtggtgttcaagaaggccccgaacctgctgttcaccgac
cacaaggacgacgagttcgggcagaacgcgttcgtgatccgggtgcagccagacgaaggc
gcgaccatccgcttctcctccaaggtgcccggcacccagatggagatccgcgacgtgacc
atggacttcggctacggcaacgcgttcaccgagtcttccccggaggcctacgagcgcctg
atcctggacgtgttgctgggcgagcctccgctgttcccgcgccatgaagaggtcgagcag
tcctggcgcatcctggatcccttcgaggagtattgggcggcccagcccgagcagccggac
ccctacgcccctggttcctggggcccggccagcagcgacgaactgatggccaaggatgga
aggacgtggcgacgcccatga

DBGET integrated database retrieval system