KEGG   Arthrobacter sp. LS16: AFL94_10255Help
Entry
AFL94_10255       CDS       T04078                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
arl  Arthrobacter sp. LS16
Brite
KEGG Orthology (KO) [BR:arl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AFL94_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Chlorophyllase MAP17 Halogen_Hydrol
Motif
Other DBs
NCBI-ProteinID: ALD64242
Position
complement(2227193..2228452)
Genome map
AA seq 419 aa AA seqDB search
MDLTLIVVLVIALALFFDFTNGFHDTANAMATPIATGAISPKKAVALAAILNLVGAFLST
EVAKTISGGIINEDPTTGVAIGPAMIFAGLMGAVIWNLLTWLLGLPSSSSHALFGGLVGA
AIVGAGFGAVNYGVLLSKVLLPAIVAPMIAGISAYLCTKLAYAITKRQSGTSPKRGGFRY
GQIFSSSLVALSHGTNDAQKTMGVITLTLVASGLQDAGTPVHFWVVAACAFAIALGTYTG
GWRIIQTMGSGLTDVKPAQGFAAEMSTASAILTSSHLGFALSTTQVASGSVIGSGLGRKG
AEVRWGTAGRIALGWLFTLPAAAIVGGLAAWITHAGTVGVIIVAVAGLVSMLAIWVLSRK
NPHTHETAMSDIDNSGAAVNILSKKERRAKAKAEAKAKQAALRAKAEREEAEEEKVDKA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggatttgacgcttatcgtcgtcctggtcattgccttggcgttgtttttcgacttcacc
aacggtttccatgacacggccaatgcgatggccaccccaatcgcaaccggggcaatctcg
cccaaaaaagcagtagccctcgccgcaattttgaacctcgtcggcgcgttcctttccacc
gaggtcgccaaaacgatctccggaggcatcatcaacgaggaccccacgaccggggtcgcc
atcggcccggccatgattttcgctggtctgatgggtgcggtgatctggaacctgctgacc
tggctgctcggcctgccatccagctcctcccacgcgttgttcggcggcctggtgggcgcg
gcaatcgtcggcgccggattcggcgccgtgaactacggcgtattgctgtccaaggtgctg
ctgccggccatcgtggccccgatgatcgcgggtatctccgcgtacctttgcaccaagctg
gcctatgcgatcaccaagcgccagtcgggaacctcgcccaagcgcggcggtttccgctac
ggccagatcttctcctcctcgctggtcgcgctgtcgcacggtaccaatgatgcgcagaag
accatgggcgtcatcaccctgaccctggtggcctccggcctgcaggacgccggcactccg
gtgcacttctgggttgtcgcggcctgtgcgttcgcgatcgcgctgggtacctacaccgga
ggctggcgcattatccagaccatgggctcgggcctgaccgacgtcaagcccgcacagggc
ttcgcggccgagatgtcgaccgcgtcggccatcctgacctcctcgcacctgggcttcgcc
ctgtcgaccacccaggtcgcttccggctccgtcatcggttcgggactcgggcgcaagggc
gccgaggtccgctggggcaccgccgggcgtatcgccctgggctggctgttcaccctgccg
gcagcggcaatcgtcggcggcctggccgcgtggatcacccacgcgggtaccgtcggagtc
atcatcgtcgcagttgccggtttggtttcgatgctcgccatctgggtgctgtcgcgcaag
aatccgcacacccacgagacggcgatgtccgacatcgacaactcgggcgccgcagtgaac
atcctgagcaagaaggaacgccgcgcgaaggccaaggccgaagccaaggcgaagcaggct
gccttgcgcgccaaggccgaacgcgaggaagctgaagaagagaaagttgacaaagcatga

DBGET integrated database retrieval system