KEGG   Arthrobacter sp. PAMC 25486: ART_0778Help
Entry
ART_0778          CDS       T03487                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
arm  Arthrobacter sp. PAMC 25486
Brite
KEGG Orthology (KO) [BR:arm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ART_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIY00377
UniProt: A0A0A1CSY6
Position
complement(757025..758428)
Genome map
AA seq 467 aa AA seqDB search
MDLTFMVVLVIALALFFDFTNGFHDTANAMATPIATGAIKPKTAVALAAILNLVGAFLST
EVAKTISGGIINEGGPNGVAITPEMIFAGLMGAVLWNLFTWLLGLPSSSSHALFGGLIGA
AIVGTWSFGAVNFMVVVSKVLLPALLAPAIAGLVAFLCTKLAYSITKRSDPDSGDKLTQK
RGGFRRGQIFSSSLVALAHGTNDAQKTMGVITLVLVASGLQTAGTGPHIWVITACALAIA
GGTYAGGWRIIRTLGSGLTDVKPAQGFAAETSTAAAILASSHLGFALSTTHVASGSVIGS
GLGRKGATVRWGAIGKIGITWLLTLPAAALVGGLAALLIRTGIVGIVIVAVLGLSAILIM
FVLSQRETVDHSNAISDVDAVGEAMHIPSKKERDRLAVKARAAQKVAEKAAKRAAETDAA
RAAAQTALDRADTAVLKAMTKAAANAHDPKDQSAKGKAKVDAKKGKK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcaccttcatggtcgtgcttgtcatagcactggcccttttctttgactttacg
aacggctttcacgacacagccaacgccatggcaacccccattgccaccggtgccatcaag
cccaagacagctgtggccctggccgcgatcttgaacctggtgggagccttcctttcaacc
gaggtggccaagaccatttccgggggcatcatcaacgagggcgggcccaacggtgtcgcc
atcactccggaaatgatcttcgccggtttgatgggcgcggtgctgtggaacctgttcacg
tggctgctcggcctgccgtcaagctcctcacacgccctgttcggcggcttgatcggagcg
gccattgttggcacctggtccttcggggcagtgaactttatggtggttgtctccaaggtg
ctgctgccggcccttctggcccccgccatcgccggtctggtcgccttcctgtgcaccaag
ctggcttactccatcaccaagcgttccgaccccgattccggtgacaagctcacccagaag
cgcggcgggttccgtcgcggccagatcttcagctcctcgctggtggctttggcccacggc
accaacgacgcccagaagaccatgggtgtcatcacccttgtccttgtggcatcggggctg
cagacggcaggcaccggcccgcacatctgggtcatcaccgcttgtgcactcgccattgcc
ggaggcacctacgccggcggctggcgcatcatccgcaccctgggatccggactgacagac
gtcaagcccgcacagggcttcgcggctgaaaccagcaccgcggccgccatcttggcctcc
agccacctgggctttgcgctctccaccacgcacgttgcctcaggctccgtcattggctcg
gggcttggccgcaagggcgcaaccgtccgctggggtgccattggcaagatcggcatcacc
tggctgttgacgctccccgccgccgccttggtgggcggcctggcagccctgctgatccgc
accggcattgtcggcattgtcattgtcgccgtgttggggctgagcgccatcctgatcatg
ttcgtcctctcccagcgcgagacagttgatcacagcaatgccatcagcgacgtcgacgca
gtgggtgaggccatgcacatccccagcaagaaggagcgcgaccgcctcgccgtcaaggca
cgcgccgcacaaaaggttgccgaaaaggcggccaagcgtgcagcagaaaccgatgccgcc
cgcgccgcagcccagacagcccttgaccgtgccgacacggccgtgctcaaggcgatgacg
aaggctgccgcaaacgcgcacgatcccaaggaccagtccgccaagggcaaggctaaagtc
gacgcgaagaaaggcaagaaatga

DBGET integrated database retrieval system