KEGG   Arthrobacter sp. PAMC 25486: ART_2433Help
Entry
ART_2433          CDS       T03487                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
arm  Arthrobacter sp. PAMC 25486
Brite
KEGG Orthology (KO) [BR:arm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ART_2433
Enzymes [BR:arm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ART_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIY02032
UniProt: A0A0A1CXR5
Position
complement(2522697..2523521)
Genome map
AA seq 274 aa AA seqDB search
MERPIAMKVSVGQFNPGADVVENLATMRRLSVAAAQDGGKLVVFPEEAMFSVGRIKGDFS
AAVDAHWTTFVQGLSMIASDVGIAVIAGGYESSGEARPYNTVVAVGDDGEILGTYRKLHL
YDAFSYQESTRIKPSDRGVTIVEIGGFKVGIMTCYDIRFPELARTLAVSGVDLLCVSAAW
FKGEHKIEHWETLLKARAIENTCWVAAAGTSSDHCIGHSAILDPMGIPTDFLNDEAEGVA
TADVTHRRIEEVREFLPVLLNRRFDSSSEVLPAG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtggagaggcccattgccatgaaggtcagcgttggacagttcaatccaggtgcagatgtt
gttgaaaacctggccacgatgcgcaggctttccgttgctgcggcacaggatggcggcaag
ctggtggtgttcccggaagaagccatgttctcggtgggacggatcaagggcgatttttcc
gcagccgttgatgctcactggaccacgtttgtccaaggactgtccatgattgcctccgac
gtggggattgccgtcatcgccggcggctacgaatccagtggggaggcccgcccgtacaat
accgtggtggcggttggtgatgacggggaaatccttggcacctaccgcaagctgcacctc
tacgacgccttttcctaccaagaatcaacccggatcaagcccagcgaccgcggtgtcacc
attgtggaaattggtggcttcaaggtgggtatcatgacctgctatgacatccgcttcccc
gaattggcccgcacgctggcagtctccggcgtggacctgctctgtgtctcggccgcctgg
ttcaagggcgagcacaagatcgagcactgggagacgctgctcaaagcccgggccattgaa
aacacctgctgggtggcggccgcaggcacctccagcgaccactgcatcggccattcggcc
atccttgaccccatgggcattccgacggatttcctcaacgacgaggccgaaggtgtggcc
acggccgacgtcacgcacaggcgcattgaagaagtgcgtgagttcttgcccgtgctgctc
aaccgccgttttgacagcagctccgaggtgctcccggcgggctga

DBGET integrated database retrieval system