KEGG   Arthrobacter sp. PAMC 25486: ART_3026Help
Entry
ART_3026          CDS       T03487                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
arm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:arm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ART_3026
Enzymes [BR:arm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ART_3026
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ART_3026
    1.1.1.-  
     ART_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C FAD_binding_3 adh_short ADH_zinc_N_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIY02625
UniProt: A0A0A1CZL6
Position
3129263..3130324
Genome map
AA seq 353 aa AA seqDB search
MRAARYYDRNDIRIEDIAEPELKPGTVAIDVAWCGICGTDLHEYLEGPIFIPPAGHPHPI
SGESAPVTLGHEFSGTITALGEGVTDLSVGENVVVEPYIIGADVDTSEGAPYQLSKDMNF
IGLGGRGGGLAEKIVVERRWVHPIGDIPLDQAALIEPLSVGHHAYVRSDAKAGQVAIVGG
AGPIGLLTAAVLKAKGLTVYISELSEARKAKALETGVADAVFDPREGDVASQVRELTNGQ
GADVGFECSSVPAVLDMLLDAVRPGAVIVNVSIWGHKPAVDMPKLVLKEVDLRGTIGYAN
DHPDTIALVQSGKLDLSRFITGRIGLDGLVSEGFDQLINNNEAHVKIIVNPRG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcacgttactacgaccgcaatgacatccgtatcgaggacattgccgagccg
gaactgaagccgggaaccgtggctattgacgttgcctggtgcggtatctgcggcaccgac
ctgcacgaatacctggaagggcccatcttcattccgcccgcaggccacccacatccgatc
tccggagagtccgctcccgtgacattgggccacgagttctccggaaccatcacggcgctg
ggtgagggggtcaccgatctgagcgtcggagaaaacgtggtggtggagccgtacatcatc
ggtgcggatgtggatacgagcgaaggtgccccgtatcagttgtccaaggacatgaacttc
atcggattgggtggtcgcggtggcggacttgccgagaagattgtcgtggaacggcgctgg
gtccacccgattggtgacattcccctggaccaggccgcgctgattgaacccctttccgtg
gggcatcatgcctacgtgcgttccgatgcaaaagccggccaggttgccatcgtgggtggg
gcggggcccattggtctgctgaccgcggctgtactcaaggccaagggtctgaccgtctac
atctccgaactttccgaggcacgcaaggcgaaagccctggaaaccggtgttgctgatgcc
gtcttcgatccccgtgagggtgacgttgccagccaggtccgcgagttgaccaatggccag
ggtgcggatgtcggatttgagtgctcatcggtgcccgccgtactggacatgctcctggac
gccgtccgcccaggtgcggtcattgtcaacgtctccatctggggtcacaaacctgctgtg
gacatgccgaagctggtgctgaaggaagtggatctgcgcggcaccatcgggtacgccaac
gaccacccggacaccatcgcgctggtccaaagcggcaagttggacctttctcgcttcatc
accggacggatcggactggacgggctggtcagtgaaggttttgaccagttgatcaacaac
aatgaagcgcacgtgaaaatcatcgtgaacccgcgcggctga

DBGET integrated database retrieval system