KEGG   Arthrobacter sp. PAMC 25486: ART_3933Help
Entry
ART_3933          CDS       T03487                                 

Definition
(GenBank) hypothetical protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
arm  Arthrobacter sp. PAMC 25486
Brite
KEGG Orthology (KO) [BR:arm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ART_3933
Enzymes [BR:arm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     ART_3933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L TilS
Motif
Other DBs
NCBI-ProteinID: AIY03532
UniProt: A0A0A1D218
Position
4113660..4114568
Genome map
AA seq 302 aa AA seqDB search
MNINEHSEAQPLRLLAVHAHPDDEASKGAAMMASYVASGVEVMVATCTGGERGDIQNPAL
IGDPHSARDMGGARRLEMAKAAKILGIKHQWLGFTDSGLPEGDPLPALPANCFAAKPLDV
AAAPLVRLVRRFRPHVIVSYDENGGYPHPDHIMSHKVSVEAFNAAGDPEQYPGTGEAWEP
SKLYYDLAFNPQRFRALHYALQDAGLASPYAERLAAWLEADPEGHTPPTSKHPTTTQIDC
GDYFETRDDALRAHATQVDPNGFFFAVSPAMQRKVWPWEDYSLIESRVPTTGPENDLFAG
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcaacgagcactcggaagcgcagccgttgcgtcttttggcggttcatgcccac
ccggacgatgaggcaagcaagggtgctgccatgatggcctcctacgttgcctccggcgtt
gaggtgatggttgccacctgcaccggcggcgaacgcggggacatccagaacccggccctc
atcggggacccgcattccgcccgtgacatgggcggtgcacgacggctggaaatggccaag
gcggccaagattctgggcatcaagcaccaatggctcggattcaccgactcgggcctgccc
gaaggcgaccccctcccggccctgccggccaactgcttcgccgccaagcccctggacgtg
gccgccgcaccgctggtccgcctggtccggcgcttccggccgcacgtgatcgtctcttat
gacgaaaacggcggctacccgcatcccgaccacatcatgtcgcacaaggtttccgtcgag
gccttcaacgcggccggcgacccggagcagtaccccggcaccggcgaggcatgggagccg
tccaagttgtactacgatctggcgttcaacccgcagcgtttccgggccctgcactacgcc
ctgcaggatgccggcctggcctcgccctacgcggaacgcctggccgcctggctcgaggct
gacccggagggacacaccccgcccacgagcaagcaccccaccaccacacagattgactgc
ggggactactttgagacccgcgacgacgccctgcgcgcgcatgccacccaggttgatccc
aacggcttcttcttcgccgtgagcccggccatgcaacggaaagtgtggccgtgggaggac
tattcgctgattgaatcccgggtgcccaccaccggacccgagaacgacctgttcgctggc
ctacgatag

DBGET integrated database retrieval system