KEGG   Arthrobacter sp. YN: CGK93_01200Help
Entry
CGK93_01200       CDS       T05171                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
arn  Arthrobacter sp. YN
Brite
KEGG Orthology (KO) [BR:arn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CGK93_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ASN18481
UniProt: A0A221NET8
Position
complement(248083..249099)
Genome map
AA seq 338 aa AA seqDB search
MTIAILVLVVGLASGFAFLNGFRDVSNAVALSTRTRALTPSIAVLLAAIFNFVGAMLSGT
FILAFTQSWITLPSGTSGLTILASALTAAILWGVYAWWRGIPLSSTNSLVGGLIGAGAAS
VLVGGNAVGGMDNVLLTQVALPLVLSPVIAFVAAYLLVWPVTWAARYTQPNVVNRRFRRA
QAVSAAAVAFGHGLQDGQRTAAVILLAMVAAGLSGGNDVPLWILLVTAIMLTAGTMFGGW
RISHTLGHKLIRVDPLRGFVSQTLTSVMLFIGAIAFHLPLSTTHTLTASVLGAGVNQRFH
TVNRRLVRRILLFWVATPLVTAAAAFILELAFSPLADL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgccatcctggtcctggtagttggcctggcttccggtttcgcattcctgaac
ggcttccgcgacgtctccaacgccgtcgcgctttccactcggacccgcgcactcactccc
tcaattgcggtgctcctggccgccatcttcaactttgtgggtgccatgctcagcggcact
ttcatccttgccttcacccagtcctggatcacgctgccgagtggcaccagcggcctgacc
atcctcgcctcggccctcactgcagccatcctgtggggagtgtacgcgtggtggcgcggc
atcccgctgtcttccaccaactcactggtgggcggcctgattggtgcaggtgcagcaagc
gtcctggtgggcggcaacgcggtaggcggcatggacaacgtcctgctcacccaagtggcg
ctgccgttggtcttgtcgcctgtcatcgcgttcgtggcggcgtacctgctggtatggccg
gtgacgtgggctgcccgctatacgcagccgaacgtggtcaaccggcggttccgccgggcg
caggccgtctccgccgccgccgtcgcgttcggccacgggctccaggacggccagcgcaca
gctgcggtcattctgctggccatggtggctgcgggattgtccggcggcaatgatgtgccg
ctctggatcctgttggtcacagccatcatgcttactgcgggcaccatgttcggcggctgg
cggatctcccacactcttggccacaagctcatcagggtggatccgctgcgaggcttcgtg
tcgcaaacactgacctccgtgatgctgttcatcggagccatcgccttccacctgccgctc
tccaccacccatacgctgacggcgtccgtgctgggtgcgggggtcaatcagcgcttccac
accgtcaacaggcgcctggtgcggaggatcctgctgttctgggtggccacgccactggtc
acagccgcagctgccttcatcctggagctggcgttctcgcccctcgcggacctgtaa

DBGET integrated database retrieval system