KEGG   Agrobacterium rhizogenes: B0909_04280Help
Entry
B0909_04280       CDS       T04767                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00340  Histidine metabolism
aro01100  Metabolic pathways
aro01110  Biosynthesis of secondary metabolites
aro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B0909_04280
Enzymes [BR:aro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     B0909_04280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AQS61568
UniProt: A0A178HBP2
Position
1:1472385..1472837
Genome map
AA seq 150 aa AA seqDB search
MSIPFPSAPADKEVLENAGLFSPKFDEHGLVTAVVTDARDGELLMVAHMNAQALSLTLET
GIAHYYSRSRGKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVGLADGRAVTTITDDTRHFDPATTYSGT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccctttccatccgcgccagcggataaggaagtgctcgaaaacgcaggcctt
ttttcaccgaaattcgatgaacacggccttgtcaccgccgtggtgaccgatgcccgtgac
ggcgaattgctgatggtcgcccatatgaatgcgcaagccctgtcgctgacgctggaaacc
ggcatcgcccactattacagccgctcgcgcggcaagatctggaagaagggcgaaacctcc
ggcaacctgcagacggtgaaggaattccgcacggattgcgaccaggacgccgtttggctg
aaggtctccgtcgccggccacgacgccacctgccacaccggtcgccgctcctgcttctac
cgcacggtggggcttgccgacggcagggccgtgaccacgattaccgacgacacccgccat
ttcgatccggcgacgacctattccggcacatga

DBGET integrated database retrieval system