KEGG   Agrobacterium rhizogenes: B0909_14435Help
Entry
B0909_14435       CDS       T04767                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aro  Agrobacterium rhizogenes
Brite
KEGG Orthology (KO) [BR:aro00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B0909_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AQS63584
UniProt: A0A178H3P0
Position
2:258379..259383
Genome map
AA seq 334 aa AA seqDB search
MDVALALPLLVGLIAIALFFDFLNGLHDAANSIATIVSTRVLRPQYAVAWAAFFNFIAFL
FFGLHVAETLGTGIIDPAIVSPQVIFAALMGAIVWNIVTWIFGIPSSSSHALIGGLVGAG
LARVGFDSIVWSGLLKTVGAIFMSPAIGFFLALLLVLAVSWLFVRQTPFAVDRTFRVMQF
ISASLYSLGHGGNDAQKTMGIIAVLLFSQGHLGESFYVPFWVVISCQSAMALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGALTLFGATWLGIPVSTTHTITGAIVGVGAARRVSAV
RWGLAGNIVIAWIVTMPAAALISAAVYGLTSLFG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgcgcttgccctgccgctgcttgtcggcctcatcgccatcgcgctgttcttc
gatttcctgaacggtctccacgacgccgcaaattccatcgccaccatcgtctccacccgt
gtgctgcgcccgcaatatgcggttgcctgggcggccttcttcaacttcatcgccttcctg
ttcttcggcctgcatgtggcggaaacgctcggcaccggcatcatcgatccggccatcgtg
tcgccgcaggtcatcttcgcggcgctgatgggtgcgatcgtctggaacatcgtcacctgg
attttcggcattccctcaagctcgtcgcacgcgctgatcggcggcctcgtcggcgccgga
ctggcgagagtgggcttcgattccatcgtctggtcgggcctgctgaagactgtcggcgca
atcttcatgtcgccggcaatcggcttcttccttgccctgcttctggtactcgccgtatcc
tggctgttcgtgcggcagacaccctttgcggtggaccgcaccttccgcgtcatgcagttc
atctccgcttcgctttattcgctcgggcatggcggcaacgacgcgcagaagaccatgggc
atcatcgccgtgctgctgttcagccaggggcatctgggcgagagcttctacgtgcctttc
tgggtggtgatttcctgccagtcggccatggcgctcggcacgctgttcggcggttggcgc
atcgtgcataccatgggctccaagatcacccggctgaacccgatgcagggcttctgcgcc
gaaaccggcggcgcgctgacattgttcggcgcgacatggctcggaattccggtctccacc
acccacacgatcaccggcgccatcgtcggcgtgggggctgcccgccgcgtctccgcggtg
cgctgggggcttgccggcaacatcgtcatcgcctggatcgtgaccatgccggcggcggcg
ctgatctccgccgccgtttatggactgacatcgctgttcggctga

DBGET integrated database retrieval system