KEGG   Agrobacterium rhizogenes: B0909_21090Help
Entry
B0909_21090       CDS       T04767                                 

Gene name
ubiG
Definition
(GenBank) bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00130  Ubiquinone and other terpenoid-quinone biosynthesis
aro01100  Metabolic pathways
aro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    B0909_21090 (ubiG)
Enzymes [BR:aro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     B0909_21090 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     B0909_21090 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 CMAS Methyltransf_9 MTS PrmA Ubie_methyltran NodS DREV ADH_zinc_N Methyltransf_32 TehB GidB MetW
Motif
Other DBs
NCBI-ProteinID: AQS64728
UniProt: A0A178H0F1
Position
2:complement(1706243..1706989)
Genome map
AA seq 248 aa AA seqDB search
MSETAQTTVDQSEVDRFSAMAAEWWSPTGKFRPLHKFNPVRLEYIRNRVCENFGRDPKAH
RPLEGLRVLDIGCGGGLLSEPVARMGATVVGADPSEKNIGIASTHARESGVNVDYRAVTA
EQLQEAGETFDVILNMEVVEHVANVDFFVTTCAKMVRPGGLMFAATINRTLKARALAIFA
AENVLRWLPRGTHQYEKLVRPEELERPMVASGMDIIHRTGVFYNVLQDRWNLSPDMDVNY
MMLAKRPA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccgcacagacgaccgtcgaccagagcgaagtggatcgcttctccgcgatg
gctgcggaatggtggagcccgacaggcaagttccgcccgctgcacaagttcaacccggtg
cggctcgaatatatccgcaaccgtgtctgcgaaaatttcggccgtgacccgaaagcacat
cgcccgctggaagggctgcgcgtgctggatatcggctgcggtggcggccttctttcggaa
cccgtggcacgcatgggcgccaccgtggtgggcgccgatccctcggaaaagaacatcggc
atcgcctccacccatgcgcgcgaaagcggggtcaatgtcgactaccgcgccgtgaccgcc
gaacaattgcaggaagcgggcgaaaccttcgatgtcatcctcaacatggaggtggtggaa
catgtggccaatgtcgatttcttcgtcaccacctgcgcgaaaatggtgcgccccggcgga
ctgatgttcgccgccaccatcaaccgcacgctgaaggctcgggcgctggccatcttcgcc
gccgaaaacgtgctgcgctggctgccgcgtggcacccatcagtatgagaaactggtccgc
ccggaagagcttgagcggccgatggtggcaagcggcatggatatcatccaccgcaccggc
gtcttctacaacgtgctgcaggatcgctggaatctctcgccggatatggatgtcaattac
atgatgctggcgaaacgcccggcataa

DBGET integrated database retrieval system