KEGG   Agrobacterium rhizogenes: B0909_25885Help
Entry
B0909_25885       CDS       T04767                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00071  Fatty acid degradation
aro00072  Synthesis and degradation of ketone bodies
aro00280  Valine, leucine and isoleucine degradation
aro00310  Lysine degradation
aro00362  Benzoate degradation
aro00380  Tryptophan metabolism
aro00620  Pyruvate metabolism
aro00630  Glyoxylate and dicarboxylate metabolism
aro00640  Propanoate metabolism
aro00650  Butanoate metabolism
aro00900  Terpenoid backbone biosynthesis
aro01100  Metabolic pathways
aro01110  Biosynthesis of secondary metabolites
aro01120  Microbial metabolism in diverse environments
aro01130  Biosynthesis of antibiotics
aro01200  Carbon metabolism
aro01212  Fatty acid metabolism
aro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0909_25885
   00630 Glyoxylate and dicarboxylate metabolism
    B0909_25885
   00640 Propanoate metabolism
    B0909_25885
   00650 Butanoate metabolism
    B0909_25885
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B0909_25885
   00072 Synthesis and degradation of ketone bodies
    B0909_25885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0909_25885
   00310 Lysine degradation
    B0909_25885
   00380 Tryptophan metabolism
    B0909_25885
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0909_25885
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0909_25885
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0909_25885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aro04147]
    B0909_25885
Enzymes [BR:aro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0909_25885
Exosome [BR:aro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0909_25885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AXO68395
UniProt: A0A178H801
Position
1:2596723..2597904
Genome map
AA seq 393 aa AA seqDB search
MTLPSIVIASAARTAVGSFNGHFANTPAHELGATVIGAVMERAGITANEVDEVILGQVLT
AGEGQNPARQAAMKAGIPQEATAFGLNQLCGSGLRAVALGMQQIATGDANIVIAGGQESM
SMAPHCAHLRSGVKMGDFKMIDTMLKDGLTDAFYGYHMGITAENIARQWQLSRDEQDQFA
VASQNKAEAAQNAGRFTDEIVAFTVKGRKADIVIDADEHIRHGASLETMAKLRPAFDKEG
TVTAGNASGLNDGAAAALLMSEQEAAKRGIKPLARIASWATAGVDPQIMGTGPIPASRKA
LAKAGWSINDIGLVEANEAFAAQSCAVVRELGLDPAIVNVNGGAIAIGHPIGASGARVLN
TLIYEMRRRNVSKGLATLCIGGGMGVAMCIEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccttcaatcgtgattgccagcgctgcgcgcaccgccgtcggctctttcaat
ggccatttcgccaatacgccagcccatgaactcggggcgaccgttatcggcgcggtgatg
gaacgtgccggcatcacggcaaacgaagtcgatgaagtcattctcggtcaggtgctgacg
gcaggcgaagggcagaacccggcgcggcaggcggcaatgaaggccggcattccacaggag
gcaaccgccttcggcctcaatcagctctgcggctccggcctgcgcgccgtggccctcggc
atgcagcagatcgcgaccggcgacgcgaacatcgtcattgccggcgggcaggaatccatg
tccatggcgcctcactgcgcccatttgcgcagcggcgtgaagatgggcgatttcaagatg
atagacaccatgctcaaggacggtctgaccgacgccttttacggttaccacatgggcatc
accgccgagaatatcgcccgccaatggcaactctcccgcgatgaacaggatcagttcgcc
gtcgcatcgcaaaacaaagccgaagcggcgcagaacgccggccgctttacggacgagatc
gtcgccttcacggtcaaaggccgcaaggccgatatcgtcatcgatgctgacgaacatatc
cgccatggagcttcgctggaaaccatggccaagctacgccccgcctttgacaaggagggc
actgtcacggccggcaatgcctccggcctgaatgatggcgcagccgccgcacttttgatg
tctgaacaggaagccgcaaaacgcggcatcaagccgctggcgcgcatcgcctcctgggca
acggcgggcgtcgatccccagatcatgggcaccgggcccattcctgcctctcgcaaggcg
ctggccaaggccggctggtcgatcaatgatatcggccttgtggaggccaacgaagccttt
gccgcccaatcctgcgcagtggtgcgcgagctgggcctcgatccggccattgtcaacgtt
aatggtggggcaatcgccatcggccatccaatcggtgcttccggcgcacgcgtcctgaac
acgctgatttatgagatgcgccgccgcaacgtatcgaagggcctcgcaacactctgcatc
ggcggcggcatgggcgtcgccatgtgcatcgaggcgctctga

DBGET integrated database retrieval system