KEGG   Agrobacterium rhizogenes: B0909_26430Help
Entry
B0909_26430       CDS       T04767                                 

Gene name
hisH
Definition
(GenBank) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00340  Histidine metabolism
aro01100  Metabolic pathways
aro01110  Biosynthesis of secondary metabolites
aro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B0909_26430 (hisH)
Enzymes [BR:aro01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     B0909_26430 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 SNO GATase_3 GATase_5
Motif
Other DBs
NCBI-ProteinID: AXO68492
UniProt: A0A178H8K9
Position
1:complement(2707605..2708255)
Genome map
AA seq 216 aa AA seqDB search
MRVAIIDYGSGNLRSATKAFERAAREAGIDATIDLTDKPDHVATADRIVLPGVGAYADCR
AGLDAVPGMHEALIEAVEKKAHPFLGICVGMQLMSSRGLEKTVSTGLGWIEGDVVEMTPS
DPSLKIPQIGWNTLEIRHTHPLFDGIKTGADGLHAYFVHSYHLAAKHSTDVIATTNYGGA
MTAFVGRDNMAGAQFHPEKSQTLGLALISNFLRWKP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgcgatcatcgactacggttcgggcaatctgcgttcggccaccaaagctttc
gagcgtgccgcccgcgaagccggcatcgacgcaaccatcgacctgaccgacaagccggat
catgtcgctacggcggaccgcatcgtgctgccgggcgtcggcgcctatgcggattgccgt
gccggcctcgatgccgttcccggcatgcatgaggcgctcatcgaagccgtggagaaaaaa
gcccatcccttcctcggcatctgcgtcggcatgcagctgatgtcctcgcgcgggctggaa
aagacggtcagcaccgggctcggctggatcgaaggcgatgtcgtggaaatgacgccgtcc
gatccgagcctgaagattccgcagatcggttggaacacgctggaaatccgccacacccac
ccgctattcgacggcatcaagaccggcgcggacgggttgcacgcctatttcgtgcattcc
tatcatctggccgccaagcattcgaccgatgtcatcgccaccaccaattacggtggcgcg
atgacggctttcgtcggccgcgacaatatggcgggggcgcaattccacccggaaaagagc
cagacgctcggccttgccctgatttccaatttcctgcgctggaagccctga

DBGET integrated database retrieval system