KEGG   Arthrospira platensis: NIES39_D02090Help
Entry
NIES39_D02090     CDS       T02608                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase/phosphomannomutase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
arp  Arthrospira platensis
Pathway
arp00051  Fructose and mannose metabolism
arp00520  Amino sugar and nucleotide sugar metabolism
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NIES39_D02090
   00520 Amino sugar and nucleotide sugar metabolism
    NIES39_D02090
Enzymes [BR:arp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NIES39_D02090
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     NIES39_D02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep PGM_PMM_II PGM_PMM_III Hexapep_2 NTP_transf_3 DUF4954 K-cyclin_vir_C
Motif
Other DBs
NCBI-ProteinID: BAI89629
UniProt: D5A5P3
Position
1820902..1823430
Genome map
AA seq 842 aa AA seqDB search
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLRRHHFQEVIATLHYLPDIM
REYFHNGSDFGVQMTYSVEEDQPLGTAGCVKNIAELLDSTFLVISGDSITDFDLSAAVKF
HTSQKSKATLILTRVPNPLDFGVVITDENQRIKRFLEKPSTSEIFSDTVNTGIYVLEPEV
LEYLPPNQECDFSNDLFPLLLDKGVPMYGFIADGYWCDVGHLEAYRESQYDALRGKVKLD
FPYEERSPGVWVGENTYIDDYARIEAPVIIGNNCRIGPRSQLEAGTILGDNVTVGSDANL
KRPIVWNGAIIGEDVHLRACVIARGARVDRRAHVLEGAVVGSLSTVGEESLISPNVRVWP
SKKIESGATLNINLIWGNTARRNLFGQRGVLGLANIDITPEFAVKLGAAYGSTLKQVATV
AVSRDQRRISRMVTRSLISGLMSVGVNVLNLEDTAIPVVRTVIRNLTVVGGIHVRLSPDR
SDQILIEFLDNKGINITKAKEKKIEGAYFKEDLRRAGVSEIGNMTYPSEVIDTYRTAFER
HLNIESLRHSNAKVVIDYVYAVSGALLPRLLAKFGCDAVVLNASLNQIAISPSDRENLLD
QLGRVVEALRANFGVQVYANGEQFILVDESGSLIRGEELTALMVTMVLTAHPRSTVVVPV
QASSAVEQIARRHDGIVIRTKANPTALMEACQAHPNVVLGGSGDMGFIFPQMHPGFDAMF
SIAKMIEILTTQERSLGQIRTDLPHVIHRRYTVRCPWSVKGALMRHLVETHAPENLELID
GVKLINYQDDNWILILPDAGEPLIHIYANSDDRDWADTTLREYRNMVQDFVNQVQGMNRE
DY
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtgctgatggctggggggtcaggaacgcgactcagacctcttacctgtgat
ttacccaaaccaatggtgcctatactcaaccgccccattgccgaacatatcattaaccta
ctgaggcggcaccacttccaggaagttatcgctaccctgcactatttacccgacatcatg
cgggaatacttccataatggcagcgactttggcgttcaaatgacctattcggtggaagag
gatcaacctctgggaactgcaggatgtgtcaaaaatattgccgaactcctagacagtacc
ttcttagtgatcagtggcgatagcattactgattttgacctcagcgccgccgttaagttt
cacacttcccaaaaatcgaaggctacgttgatattaacccgggttcccaaccccctcgat
tttggcgtggtgattacggacgagaatcaacgcatcaagcggtttttagaaaaaccctcc
accagcgaaatattttccgatacggtcaacacgggaatctatgtcctagaaccggaagtc
ctggaatatctgccccctaatcaggaatgcgatttttccaacgacctttttccgctttta
ttagacaaaggggttcctatgtatggctttattgcagacggttactggtgcgatgtgggt
catttagaagcctatcgtgaatcccaatatgacgcattacgcggaaaagttaagctagat
tttccctacgaagagcgatcgccaggagtctgggtcggggaaaacacctacattgatgat
tatgcccgcattgaagccccagtcattattggtaataactgtagaattggaccgcgatcg
caattagaagccggaactatcctcggagataatgtcactgtagggagtgatgctaacctg
aaacgccccattgtttggaatggagccattatcggtgaggacgtacatttacgcgcctgt
gtgattgctagaggagccagggtagaccgccgcgcccacgtcctggaaggggcagtagtc
ggctccctatccaccgtaggagaagaaagcctgatcagccccaatgtccgcgtttggcct
agtaaaaaaattgaatctggggctaccctcaacatcaacctaatttggggaaacaccgct
aggcgtaaccttttcggtcaacggggggttctcggactcgctaacattgatattaccccc
gaatttgcggttaaactaggagccgcctacgggtcaactctcaaacaagtcgccaccgtt
gcggtatcccgtgaccaacggcggatttctcgcatggtaacgcgatcgctaatttcgggc
ttgatgtccgtgggagtcaatgtccttaacctagaagacaccgctattcccgtagtccgc
accgtgattcgtaacctcaccgttgttggcggtattcatgtgcgcctatctccagatcgc
tccgatcagattctgattgaatttctcgacaacaaaggcattaacatcaccaaagccaaa
gagaaaaaaattgaaggtgcttacttcaaggaagacctgcgacgcgccggagtctccgaa
attggtaacatgacctaccccagcgaagtgatcgacacctaccgcaccgcctttgaaaga
cacctcaatatcgaaagcctgcgccacagcaacgctaaagtggtgatagattacgtctat
gcagtatcgggagcccttttaccccgactactggctaagtttggttgtgatgcggtcgtc
ctcaatgctagtctgaatcaaattgctatttccccaagcgatcgcgaaaacctactcgat
caactgggccgagtggtggaagccctgagagctaatttcggcgttcaagtctatgctaac
ggcgaacagtttattttagtagatgaaagtggtagcctaattaggggagaagaactaacc
gccctgatggtgactatggttctgaccgctcaccccagaagcacggtggtagtacccgtt
caagcctcctccgccgtcgaacaaatcgcccgacgacacgatggcatagttatccgcact
aaagccaaccccacggctttaatggaagcctgtcaagctcatcctaatgtcgtactcggc
ggtagtggtgatatggggttcatcttcccccaaatgcaccccggttttgatgccatgttc
tcgattgccaaaatgattgaaattctgaccacacaggagcgatcgctcggtcaaattcgc
accgatctcccccatgtcatacaccgtcgctatactgttcgttgtccttggtctgttaaa
ggcgcactcatgcgacatctagtagaaacccatgccccagaaaacttagaattgatcgat
ggagtcaaactcattaactaccaagacgataattggattttgatccttcccgatgccgga
gaacccctaatccatatctatgccaacagcgacgatcgagattgggctgatactaccctc
agagaataccgaaatatggtacaagattttgtaaatcaagttcaaggtatgaaccgagaa
gactattag

DBGET integrated database retrieval system