KEGG   Arthrospira platensis: NIES39_D06440Help
Entry
NIES39_D06440     CDS       T02608                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
arp  Arthrospira platensis
Pathway
arp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:arp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NIES39_D06440 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:arp03011]
    NIES39_D06440 (rplV)
Ribosome [BR:arp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NIES39_D06440 (rplV)
  Bacteria
    NIES39_D06440 (rplV)
  Archaea
    NIES39_D06440 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAI90061
UniProt: D4ZPG6
Position
2227052..2227405
Genome map
AA seq 117 aa AA seqDB search
MAVSTTSEVKAIARYIRMSPLKVRRVLDQIRGRSYREALIILEFMPYRACTPVLKVLRSA
VANAEHNQGLDPATLIVSQAFADAGPSLKRYRPRAQGRAYPIRKPTCHITVTVAPAE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagcactacatcagaagtaaaagcgatcgctcgttacataagaatgtccccc
ttgaaagtccggcgggtacttgatcaaattcgcggacgtagctatcgcgaagccctgatt
atcctggagtttatgccctaccgcgcctgtactcctgtcttgaaagttctgcgatcggct
gttgctaacgctgaacataaccagggtttagacccggccactctgatcgtttcccaagcc
ttcgccgacgcgggaccaagcctgaaacgctaccgccctcgcgcccaaggtcgagcttat
cccattcgcaaacctacctgtcacattaccgtgacagtcgcccctgcggaatag

DBGET integrated database retrieval system