KEGG   Arthrospira platensis: NIES39_K02850Help
Entry
NIES39_K02850     CDS       T02608                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
arp  Arthrospira platensis
Pathway
arp00630  Glyoxylate and dicarboxylate metabolism
arp00710  Carbon fixation in photosynthetic organisms
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01120  Microbial metabolism in diverse environments
arp01130  Biosynthesis of antibiotics
arp01200  Carbon metabolism
Module
arp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
arp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
arp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES39_K02850 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES39_K02850 (rbcL)
Enzymes [BR:arp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES39_K02850 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAI91932
UniProt: D4ZVW7
Position
complement(4152769..4154199)
Genome map
AA seq 476 aa AA seqDB search
MSYSQTQTKSKAGYQAGVKDYKLTYYTPDYTPKDTDILAAFRVSPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYHIEPVPGEDNQFFCFVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRGLRLEDMRIPIAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEIKGHY
LNVTAPTCEEMMKRAEFAKEIGTPIIMHDFFTAGFTANTTLARWCRDNGLLLHIHRAMHA
VVDRQRNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHIEEDRS
RGIFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLFREGGDVIREACKWSPELAVACELWKEIKFEFEAMDTL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactctcaaactcaaaccaaatcgaaagccggatatcaggctggtgtaaaagac
tataagctgacgtattacacgccggattacacacccaaagatacagatattctggcagcg
ttccgtgtttcacctcaaccaggagttcccccggaagaagcgggagcagcagtagcagca
gaatcttcaaccggaacttggacaactgtatggactgacctgttaacagacctcgatcgc
tacaaaggtcgttgctaccacatcgaaccagtacccggcgaagacaatcagtttttctgc
tttgttgcctatcccttggatctgtttgaagaaggttctgttaccaatatgttaacctcc
atcgtgggtaacgtatttggatttaaggcactgcggggcttgcgcctggaagatatgcgg
attccaattgcttacctcaaaaccttccaaggccctccccacggtatcaccgttgagcgg
gacaaattgaacaaatacggtcgtcccctgttgggttgcacaatcaaacctaaactgggt
ctgtcggctaaaaactacggtcgggcggtttatgagtgtctgcgtggtggtttagacttc
accaaagacgacgaaaacatcaactctcaaccattcatgcgctggcgcgatcgcttccta
tttgtacaagaggcgatcgaaaaagcccaggctgaaaccaacgaaattaagggtcactac
ctaaacgtaacagcccccacctgcgaagaaatgatgaaacgggcggaatttgccaaagaa
atcggcacccccatcatcatgcacgacttcttcaccgctggttttaccgccaacaccacc
ctggctcgttggtgtcgtgataatggtctgttgctgcacattcaccgcgctatgcacgcc
gtggttgaccgtcaacgtaaccacggtatccacttccgggttctcgccaagtgtctacgg
atgtccggtggtgaccacctgcactctggtacagttgtaggtaaactcgaaggtgaaaaa
ggtatcaccatggggtttgtagacctgatgcgggaagaccacatcgaagaagatcgttct
cgtggtatcttctttacccaagattgggcttctatgcctggtgtaatgcctgttgcttcc
ggtggtattcacgtttggcatatgccagctttggtagaaatcttcggtgatgattcctgc
ttacagttcggtggtggtactttgggacacccatggggtaatgctcctggtgcaactgct
aaccgtgtggctctcgaagcctgcatccaagctcgtaacgaaggccgtaacctgttccgt
gaaggcggcgacgtgattcgtgaggcttgcaagtggagtcctgaactggctgtggcttgc
gaactttggaaagaaatcaaattcgagttcgaggctatggataccctgtag

DBGET integrated database retrieval system