KEGG   Arthrobacter sp. QXT-31: BWQ92_04895Help
Entry
BWQ92_04895       CDS       T05056                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BWQ92_04895
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BWQ92_04895
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BWQ92_04895
    1.1.1.-  
     BWQ92_04895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C CEBP_ZZ 2-Hacid_dh_C ADH_N_assoc NAD_binding_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: APX01154
UniProt: A0A1P8LZE2
Position
complement(1081916..1082971)
Genome map
AA seq 351 aa AA seqDB search
MKAARFHARKDIRIEDIPEPELRAGAVKIDVAWCGICGTDLHEYLEGPIFCPPPGQPHPL
SHEESPVTLGHEFSGTVSEIGEGVTGLAKGDNVVVEPYFVDGDCDMCQAGSYHLCRQMGF
IGLSGGGGGLSEKIVVDQRWVHPIGDIPLDEAALIEPLSVAHHAVARSGVKAGDTALVGG
SGPIGLLTAAVLKGMGVTTIISELTQARKEKATSSGVADHVLDPSKEDVPARVRELTGGT
GADVAFECAGVNAVLDTMLDSVRPGAVVVNVSIWGAPATVDMQKLVLKEIDLRGTIAYVR
DHPAVIKMVQEGKVDLKPFITGRIALEDLVEQGFDTLINHKDTAVKVLVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgattccacgcccgcaaggacatccgcatcgaggacatcccggagccg
gaactccgcgcaggggcggtgaagatcgacgtcgcgtggtgcgggatctgcggcacggac
ctgcacgaatacctggaagggcccatcttctgtcctcctcccggccagccgcacccgctc
tcccacgaggaatccccggtgaccctggggcacgaattctccggcactgtctcggaaatc
ggcgaaggggtgacgggcctggcgaaaggggacaacgtcgtcgtcgaaccctattttgtg
gacggcgactgcgacatgtgccaggccggcagctaccacctgtgccggcagatgggcttc
atcgggctgtccggcggcgggggagggctgagcgagaagatcgtggtggaccagcggtgg
gtgcaccccatcggggacattccgctggatgaggcggcgctgatcgagccgctgtccgtg
gcgcaccacgccgtggcgcgcagcggcgtgaaggcgggcgacacagcgctggtgggcggg
tccgggcccatcgggctgctcaccgccgccgtcctgaagggcatgggggtgaccacgatc
atcagcgaactcacccaggcgcgcaaggaaaaagccacctccagcggcgtggcggaccac
gtcctggacccgagcaaggaggacgtcccggcgcgggtgcgcgagctgaccggcgggacg
ggggccgacgtcgcgttcgaatgcgccggcgtgaacgcggtgctggacaccatgctcgac
tccgtccggccaggcgccgttgtggtcaacgtgtccatctggggcgcgcccgccacggtg
gacatgcagaagctggtgctcaaggagatcgacctgcgcggcaccatcgcctacgtccgg
gaccaccccgccgtgatcaagatggtgcaggagggcaaggtggacctcaaacccttcatc
accggccggatcgcgctggaggacctggtggagcagggcttcgacaccctgatcaaccac
aaggacacggcggtgaaggtgctggtgcacccgtag

DBGET integrated database retrieval system