KEGG   Arthrobacter sp. QXT-31: BWQ92_09245Help
Entry
BWQ92_09245       CDS       T05056                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00670  One carbon pool by folate
arq01100  Metabolic pathways
arq01120  Microbial metabolism in diverse environments
arq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BWQ92_09245
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BWQ92_09245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: APX04424
UniProt: A0A1P8M8T2
Position
complement(2039361..2040173)
Genome map
AA seq 270 aa AA seqDB search
MRFNHLPVRLEIIPTDGIIRDVQAHVPAGSTLTVTCLPHHGPEATVRAAVQLGGLGYNVI
PHLAARGLSSRTQLAGLLRECEAAGITEVFAIGGDAVEAAGPYGNSLRLMEDIAELTGGS
MAIGVAGYPEGHPKRNELDMLDALLEKQHLASSVVTQMCFSATRIGWYAELLRREGVGLP
IWAGVAGAVPKAKLISLATKIGVGPSLKFLNRKGPLARRLLNAGSYSSTSLVSELAATEP
ALAGIHLYTFNNVEAQPATDWSTPAGANAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgcgattcaaccacttgccggtgcgtctggagatcattcccacggacggcatcatccgc
gacgtccaggcgcacgttcctgccggatccacgctgacggtgacctgtttgccgcaccac
gggccggaggccaccgtgcgggccgccgtgcagctgggcgggctcggctacaacgtgatt
ccccacctggccgctcggggcctcagcagccggacccagctggcgggcctgctacgcgag
tgcgaggccgcgggcatcaccgaggttttcgcgatcggtggcgatgccgtggaagccgcc
ggtccctatggcaacagcctccggctcatggaggacattgccgaactgaccggcggaagc
atggccatcggcgtggccggatatccggaaggccatccgaagcgcaacgagctggacatg
ctcgatgcactcttggagaagcagcatctggcctcgagcgtggtcacccagatgtgcttc
tcggccacccggatcggctggtacgccgaactgctccgccgcgagggtgtcggccttccc
atctgggcgggagtggccggggccgtccccaaggccaagctgatctcgctggccacgaag
atcggggttggtccgtcgctgaagttcctgaaccgcaagggaccgctcgcgcgccggctc
ctgaacgccggcagctactcatccacgtccctggtctcggaactggccgccacggaacct
gcactcgcgggcatccacctctacaccttcaacaacgtcgaagcccagcccgcgacggac
tggagcactccggcaggcgccaacgcctcctga

DBGET integrated database retrieval system