KEGG   Arthrobacter sp. QXT-31: BWQ92_10195Help
Entry
BWQ92_10195       CDS       T05056                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00040  Pentose and glucuronate interconversions
arq00053  Ascorbate and aldarate metabolism
arq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BWQ92_10195
   00053 Ascorbate and aldarate metabolism
    BWQ92_10195
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BWQ92_10195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APX02026
UniProt: A0A1P8M1T5
Position
2252199..2253812
Genome map
AA seq 537 aa AA seqDB search
MPLTGHSLIAGQTVAGEGKTTFAFNPASNEQLEPAYTLLTEEQLRAATAAAAEAFASFST
LDPETHAAFLDAIADNIEAIGDELIVRAGQETGLPAARLTGERARTTGQLRLFANVVRQG
DFRGVRIDPALPDRTPLPRADIRQRQIPLGPVAVFGASNFPLAFSTAGGDTASALAAGCP
VVFKAHNAHPGTSELVGQAIAKAVRDAGLHPGVFSLIYGPGSSIGQALVADPAIKAVGFT
GSQSAGIALMRTAAARPEPIPVYAEMSSLNPVFVFPGALDGPAEQIDALAQQYITAVTGS
SGQLCTSPGLLFAPAGEAGDKLAAAVGRAVAACAGQTMLTAGIADSWNSGTQALGAAENV
TVVGTGTPGPTENAPAPAIYGTEIRDFITNEVLHTEIFGAASLVIRYSSAEELVEAANRL
EGQLTASLQLTEEDYPTAAQLIPALEQKVGRIIVNGWPTGVEVGHAMVHGGPFPATSDTR
TTSVGTLAINRFLRPVAYQNLPQELLPAALQDANPWHLNRRIDGTVVAAEEKEEVNA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgccccttaccggacactccctgatcgctggacagaccgttgccggcgaaggcaagaca
accttcgccttcaacccggccagcaacgaacagctcgagcccgcctacaccctgctcacc
gaggagcaactcagggctgccaccgccgcggcggccgaggccttcgcgtccttcagcacg
ctggaccccgaaacccacgccgcgttcctggacgcgatcgcggacaacatcgaagcgatc
ggcgatgaactgatcgtccgcgccggccaggaaaccggcctgcccgccgcccgcctgacc
ggcgaacgcgcccgcaccaccggccagctgcggctcttcgccaacgtggtccgccagggc
gacttccgcggtgtgcgcatcgacccggccctgccggaccgcacgcccctgccgcgcgct
gacatccgccagcgccagatcccgctgggcccggtcgccgtcttcggtgccagcaacttc
ccgctggccttctcgacggcgggcggcgacaccgcgtctgccctcgccgcgggctgcccc
gtggttttcaaggcccacaacgcccaccccggcaccagtgagctggtgggccaggccatc
gccaaggccgtccgcgacgccggcctgcacccgggcgtcttctccctcatctatggcccc
ggttccagcatcggccaggccctcgtcgccgacccggcgatcaaggccgtcggcttcacc
ggctcccaaagcgcaggcatcgcgctgatgcgcaccgccgccgcacgcccggaaccgatc
cctgtctacgcggagatgtcctcgctcaacccggtgtttgtcttccccggcgccctggac
ggcccggccgaacagatcgatgcactggcacagcagtacatcaccgccgtgaccggcagc
tcgggtcagctgtgcacctcccccggcctgctgttcgcccccgccggtgaggcgggcgac
aaactggctgccgccgtcggccgcgctgttgccgcctgcgccggccagacaatgcttact
gcagggatcgccgattcctggaactccggcacccaggcgctcggcgccgctgagaacgtg
accgtcgtcgggaccggaacccccggccccaccgagaatgcaccggcaccggccatctac
ggcaccgaaatccgcgacttcatcaccaacgaggtcctgcacactgaaattttcggcgcc
gcatccctggtgatccgctactcctccgccgaggaactcgtcgaggcggccaaccggctc
gaggggcagctcaccgcgtccctgcagctcaccgaagaggactacccgacggcggcacaa
ctgatcccggcgctggagcagaaggtggggcgcatcatcgtcaacggctggcccaccggc
gtcgaagtcggccacgccatggtccatggcggccccttcccggccacctctgacacacgc
accacctccgtgggtacgctggccattaaccggttcctccggcccgtggcctatcagaat
ctgccgcaggaactcctcccggcagccctccaggacgccaacccgtggcacctgaaccgc
cggattgacggcaccgttgtggccgctgaagagaaagaggaggtcaacgcatga

DBGET integrated database retrieval system