KEGG   Arthrobacter sp. QXT-31: BWQ92_15875Help
Entry
BWQ92_15875       CDS       T05056                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00860  Porphyrin and chlorophyll metabolism
arq01100  Metabolic pathways
arq01110  Biosynthesis of secondary metabolites
arq01120  Microbial metabolism in diverse environments
Module
arq_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BWQ92_15875
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BWQ92_15875
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BWQ92_15875
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BWQ92_15875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Pyr_redox Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: APX02991
UniProt: A0A1P8M4L7
Position
3504821..3506092
Genome map
AA seq 423 aa AA seqDB search
MAIQDIYPTALRLLGRPVLVVGGGRVAARRAKGLLDAGARVTVVAPEATAPLRELADAGL
LTWEPRTYRSEDVDGVWFVQTATGDPAVDTRVAADAEAQRVWCVNASDHESSAAWTPAVA
EVDDVKIAVNAGGDPRRAMALRDAVATALESGDLPLRRRRAHRGSVALVGGGPGDTGLIT
VRGRRLLGQADVVVADRLGPRELLNELAPDVRVIEVGKTPGHHPVPQAEINRILVEEALQ
GHRVVRLKGGDPYVLGRGGEEAEFCRQHGVEVEVVSGVTSAISVPAAAGIPVTHRGLAKG
FSVVTGHEELSEVPARPDHTIVLLMGVGQLRESASALGKAGLPADTPVGIVENGYLPDQR
VTIGTLGTIADQAEAAGVANPAVIVIGDVVRVSPFAPSHFKTADYSTTSPNKPRTSTTRV
LTP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcaggacatttaccccacggcgctgcgcctcctcggccgccccgtgctggtg
gtgggcggcggacgcgttgctgcgcgccgcgcgaagggcctgctcgacgccggtgcccgc
gtcaccgtggtcgcccccgaggccaccgccccgctccgcgaacttgccgacgccggcctg
ctcacctgggagccccgcacctaccgctcggaggatgtcgacggcgtctggttcgtccag
accgccaccggcgatcccgccgtcgacacccgtgtagccgccgacgccgaagcgcagcgc
gtctggtgcgtcaatgcttccgaccacgagtcgtccgccgcctggacgccggccgtcgct
gaagtggacgacgtcaagatcgccgtcaacgccgggggagacccgcgccgtgcgatggcc
ctgcgcgacgccgtcgccaccgccctggaatccggcgacctgccgctccgccgccgccgt
gcccaccgcggatcagttgccctcgtgggcggcggccccggcgataccggcctcatcacc
gtccgcggccgccggctgctcggccaggccgacgtcgtggttgccgaccgcctcggcccg
cgggaactgctcaatgagcttgcccctgacgttcgcgtcatcgaggtcggcaagaccccc
ggccaccaccccgtcccgcaggcggagatcaaccggatcctcgtcgaagaggcgctgcag
ggccaccgagttgtccggctcaagggcggcgacccctacgtcctcggccgcggcggcgag
gaagcggaattctgccgccagcacggcgtcgaggttgaagttgtttccggcgtgacgtcg
gcgatctccgtccccgccgccgccggcatcccggtcacgcaccgcggcctggccaagggc
ttcagcgtggtcaccggccacgaggaactgtccgaggtgccggcccgtcccgatcacacg
attgtcctgctcatgggcgtcggccagctgcgcgagtccgcgtccgccctcggcaaagcc
ggtctgcccgctgacacgccagttggtatcgtggagaacggctacctgccggaccagcgc
gtcacgatcggcaccctcggcaccattgccgaccaggccgaggccgccggcgtcgccaat
cctgcagtgatcgtcatcggtgacgttgtccgcgtcagccctttcgcgccgtcgcacttc
aaaaccgctgactacagcaccaccagccccaacaagccccgcacaagcaccacccgcgtt
ctcaccccctga

DBGET integrated database retrieval system