KEGG   Arthrobacter sp. Rue61a: ARUE_c04490Help
Entry
ARUE_c04490       CDS       T02215                                 

Definition
(GenBank) putative aldehyde-dismutating formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00625  Chloroalkane and chloroalkene degradation
arr00680  Methane metabolism
arr01100  Metabolic pathways
arr01120  Microbial metabolism in diverse environments
arr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    ARUE_c04490
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ARUE_c04490
Enzymes [BR:arr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     ARUE_c04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP HI0933_like DUF3482
Motif
Other DBs
NCBI-ProteinID: AFR27384
UniProt: J7LS64
Position
complement(456457..457680)
Genome map
AA seq 407 aa AA seqDB search
MTMSGNRAVAYKEPGVVEIIDTDYPTFELKDGPGVNPANVGRKVPHGAILRTVTTNICGS
DQHMVRGRTTAPQDLVLGHEITGEVVEVGPDVEFIKVGDIVSVPFNISCGRCRNCKEQKT
GICLNVNPDRPGSAYGYVDMGGWVGGQAEFVLVPYADWNLLRFPDRDQALEKIMDLTMLS
DIFPTGFHGAVTAGVGVGSTVYVAGAGPVGLAAAVGAQLLGAAVVIVGDMNEDRLAQARS
FGCETVNVSNGDPKEQIAQILGVPEVDCGVDAVGFEARGHGKDASHEAPATVLNSLMDIT
AAGGSLGIPGLYVTGDPGGIDDAAKHGSLSLSLGTGWAKSLSFTTGQCPVMKYNRQLMMA
ILHDKVQIAKAVNAKAIPLEDAPRGYAEFDAGAATKFVLNPNGYVKA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgtcaggaaacagagcagtcgcctacaaggaacctggtgtcgtggagatcatt
gacactgactacccaacgtttgagctcaaggacgggccgggcgtcaacccagccaacgtc
gggcggaaagtgccgcatggcgcgatcctgcgaaccgtgaccaccaatatttgcggttcg
gaccagcacatggtccggggtcgcaccacagccccgcaggacctggtcctcggccacgaa
atcaccggcgaagtggtggaagtagggcccgacgtcgagttcatcaaggtgggcgacatc
gtctccgtgccgttcaacatctcctgcggccgctgccggaactgtaaagaacagaagacc
ggcatctgcctcaacgtcaaccccgaccgccccggcagcgcctacggctacgtcgacatg
ggaggctgggtgggcggacaagcagagttcgtcctggttccctacgccgactggaacctg
ctgcgcttcccggaccgcgatcaggccctggaaaagatcatggacctgaccatgctctcg
gacatcttccccaccggcttccacggcgccgtcaccgccggcgtgggcgtaggctccacc
gtttacgtggcaggtgccgggcccgtgggccttgctgctgccgtcggcgctcagctgctt
ggcgccgccgtcgtgattgtgggcgacatgaacgaggaccgcctggcacaggcgcgctcc
ttcggctgcgaaaccgtcaacgtgtccaacggcgatccgaaggagcagatcgcacagatc
ctcggcgtgcctgaggtggactgcggcgtggacgcggttggtttcgaagcccgcgggcac
ggtaaggatgcctcccacgaggctccggccaccgtattgaactccctcatggacatcacg
gccgccggcggatccttgggtatcccgggcctctacgtcacgggcgacccgggcggaata
gacgacgcagccaagcacggttccctttcgctgtccctgggcacgggctgggccaagtcc
ttgtccttcaccaccggccaatgcccggtcatgaagtacaaccgtcagctgatgatggcc
atcctccatgacaaggtccagatcgccaaggcagtcaacgccaaagccatcccgctcgaa
gacgctccgcgcggctacgccgaattcgacgcgggcgcggcaacaaagttcgtgctgaac
cccaacggctacgtgaaggcgtag

DBGET integrated database retrieval system