KEGG   Arthrobacter sp. Rue61a: ARUE_c12750Help
Entry
ARUE_c12750       CDS       T02215                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00900  Terpenoid backbone biosynthesis
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01130  Biosynthesis of antibiotics
Module
arr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ARUE_c12750 (ispE)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ARUE_c12750 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFR28195
UniProt: J7LLG4
Position
1369748..1370740
Genome map
AA seq 330 aa AA seqDB search
MNPGNRKPSSLPFVGERFHARTVRVKAPGKVNVSLSVGPLRPDGYHSVASVYLAVSLYEE
VAATSTEAPGITVSISPDSTLDLDGVDIPLDERNLAYKAAAIMAEMSEKPTGVHLEITKR
VPVAGGMGGGSADAAATLLACDALWNSGLSREELAHLAAELGADVPFSLLGGTAVGLGVG
DKLSPALAKAQMDWVLVFADYGLSTPDVFRTLDGLRDSEGVEIPEPVDVDPTILQALRKG
DPETLSRVLINDLQRASITLAPQLRDTIGLGEARGALAGMVSGSGPTIALLARDSVSASV
LAEELTHRGHNALAVHGPVPGARIISDTLL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgggtaaccgcaagccaagcagcctcccgttcgtgggggagcgcttccatgcc
cgcacagtccgcgtcaaagccccgggcaaggtcaacgtctccctgagcgtcgggccgttg
cggcccgatggataccactcggtagccagcgtgtacctcgccgtttccctgtacgaggaa
gtggcagccaccagcacagaggcgccaggaatcactgtcagcatcagcccggacagcaca
ctggacctggacggcgtggacatccccctggacgagcgcaatctggcgtacaaggctgca
gccatcatggctgaaatgtcagagaagccaaccggcgtgcacctggaaatcaccaagcgt
gtgcccgtggccggtggcatgggcggcggttctgccgatgccgcagccaccctgttggcc
tgcgatgcactctggaatagtggtctttcacgcgaggaactcgcgcacctggccgccgag
ttgggcgcagacgtgccgttctcgctcctgggaggcaccgccgtcgggcttggcgtggga
gacaaactctcgccggccctggccaaggcccaaatggattgggtgctggtttttgccgac
tacgggttgtccacacctgacgtgttccgcacgcttgacggacttcgggattcggaaggc
gtcgagattccagagcccgttgacgtggatcccaccatcctccaggccctgcgtaagggt
gaccctgagaccctcagccgcgtgctgatcaacgatctccagcgggcatccatcacactc
gcgccccaacttcgcgacaccataggactgggtgaagcacgaggcgcccttgccggcatg
gtctcaggctcgggaccaaccatcgcactcctggcccgggattccgtctcagccagcgtt
cttgccgaagagctgactcaccgtggacacaatgccctggccgttcacggtcctgtgccc
ggcgcccggatcatctccgataccctcctttag

DBGET integrated database retrieval system