KEGG   Arthrobacter sp. Rue61a: ARUE_c14450Help
Entry
ARUE_c14450       CDS       T02215                                 

Gene name
scoB
Definition
(GenBank) putative succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00072  Synthesis and degradation of ketone bodies
arr00280  Valine, leucine and isoleucine degradation
arr00650  Butanoate metabolism
arr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ARUE_c14450 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ARUE_c14450 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARUE_c14450 (scoB)
Enzymes [BR:arr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     ARUE_c14450 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AFR28361
UniProt: J7LU29
Position
1577937..1578689
Genome map
AA seq 250 aa AA seqDB search
MTDNTYQDIPPRPEAVRHEYRRADVEHHEAKGWTRNELAARVAKELTNGQYVNLGIGMPT
LIPNYIPDGVEVILHSENGILGVGPYPAEDKVDPDLINAGKETVTTNAGAAFFDSASSFG
MIRGGHVDVAVLGAMEVAANGDLANWMIPGKMVKGMGGAMDLVFGAKKVIVMMEHMDRSG
RPKIVQDCTLPLTGKGCVDRIITDLAVIDVVKDEGDPRLVLRELAPNVTLEDVLAATGAE
LFEEDQELTV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaacacgtaccaggacatcccgccccgtcccgaagccgtccggcacgaatac
cgtcgcgccgacgtcgaacatcacgaggccaaaggctggacccgcaacgaactggccgcc
cgcgtggccaaggaactcaccaacgggcaatacgtgaacctgggaatcgggatgcccact
ctgatccccaactacattccggacggcgtggaggtcattcttcactctgagaacgggatt
ctgggagtgggcccgtacccggctgaggacaaggtggatccggacctgattaacgccgga
aaggaaaccgtgaccacgaatgcgggtgctgcgttcttcgactcggcgtcgtccttcggc
atgatccgcggcggacatgtggacgtcgctgtgttgggtgccatggaggtggccgcgaac
ggtgacctggccaactggatgattccaggcaagatggtcaagggcatgggtggtgccatg
gacctggtgttcggcgccaagaaggtcattgtcatgatggaacacatggaccgcagcggc
aggccgaaaatcgtccaggactgcacgctcccgctcacaggaaaggggtgtgtggaccgc
atcatcactgacctggcagtcatcgacgtcgttaaggatgaaggtgacccacgcttggtc
ctccgcgagttggcgcccaacgtcacgcttgaggacgtcctggccgctacaggggccgag
ctgttcgaggaagaccaggagctcactgtatga

DBGET integrated database retrieval system