KEGG   Arthrobacter sp. Rue61a: ARUE_c16380Help
Entry
ARUE_c16380       CDS       T02215                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase PpgK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00010  Glycolysis / Gluconeogenesis
arr00520  Amino sugar and nucleotide sugar metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
arr01200  Carbon metabolism
Module
arr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c16380 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c16380 (ppgK)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ARUE_c16380 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFR28550
UniProt: J7LMI1
Position
complement(1787310..1788128)
Genome map
AA seq 272 aa AA seqDB search
MIGNALSKKDEKTHKNAPLIGIDIGGTGIKGGIVDLKKGKLIGDRFRVPTPQPATPEAVA
EVVAQIVEELSSRPDAPAADSPVGVTFPGIIQHGVVNSAANVDKTWLGTDIDAAFTKRLG
RPVEVINDADAAGLAEARYGAGEGVDGTVLVITLGTGIGSAFIFNGQLVPNAELGHLEVD
GHDAETKASAVARERDGLSWDEYGVLLNRYLQHVEFLFSPELFIVGGGISKRSDEYFPHL
ELRTKIVTAKLKNDAGIVGAALEVALHHKLAK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaaatgcattgtccaagaaggatgagaagacccataagaacgcccctttgatc
ggtatcgacatcggcggcaccggcatcaagggcggcattgtcgacctgaagaagggcaag
ctgattggcgaccgcttccgcgttcccactccgcagcccgccactccggaggccgtggcc
gaggttgtcgcccaaatcgttgaggaactctccagccgccccgacgctccggcagccgac
tcacccgtgggtgtcacgttccccggcatcatccagcacggcgtagtcaactctgcggca
aacgtcgacaagacctggctcggcaccgacatcgatgccgcgttcaccaagcgcctcggc
cgccccgtagaggtcatcaatgatgccgacgcggccggcctcgctgaagcccgctacgga
gccggcgagggcgtggacggcactgtcctggtgatcacactgggtaccggcataggatcg
gccttcatcttcaacggacagttggtccccaatgccgagctcggccaccttgaagtggac
ggacacgacgccgagaccaaggcatccgccgtggcacgcgaacgcgatggcctcagctgg
gacgagtacggggtccttctcaaccgctacctccagcacgtggagttcctgttctccccc
gaactcttcattgtgggtggcggcatttcgaagcgctccgacgagtacttcccgcacctc
gaactgcggaccaagatcgtcaccgccaaattgaagaatgacgccggcatcgtcggtgcc
gctctcgaggtcgctttgcaccacaagctcgcgaagtaa

DBGET integrated database retrieval system