KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_00660Help
Entry
ADJ73_00660       CDS       T04014                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00450  Selenocompound metabolism
ars00970  Aminoacyl-tRNA biosynthesis
ars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ADJ73_00660
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ADJ73_00660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ars01007]
    ADJ73_00660
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ars03016]
    ADJ73_00660
Enzymes [BR:ars01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ADJ73_00660
Amino acid related enzymes [BR:ars01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ADJ73_00660
Transfer RNA biogenesis [BR:ars03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ADJ73_00660
 Prokaryotic type
   Other AARSs
    ADJ73_00660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF1010
Motif
Other DBs
NCBI-ProteinID: AKT50205
UniProt: A0A0K1F6C6
Position
1:complement(136581..138479)
Genome map
AA seq 632 aa AA seqDB search
MSKVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVAA
DKEGVTAQELADKNNAVIVQDLVDLGLSYDLFTRTTTRNHYSVVQEMFRVCHANGYMVEE
TTKGAISPSTGRTLPDRYVEGTCPICGFPDARGDQCDNCGNQLDPTELIDPRSKINGETP
QFVETQHFFLDLPALAEALTVWLDGREATGTWRPNVIKFSQNLLKDVRPRAMTRDIDWGI
PVPLDGWRDQRTKRLYVWFDAVIGYLSASIEWARRIGDEERWREWWSDEAGADASSYYFQ
GKDNITFHSQIWPAELLAYAGEGAKGGEAGVFGAPSLPTEVVASEFMTMEGKQFSSSRGV
VIYVGDMLSRYQPDALRYFICAAGPENQDSDFTWAEFVQRTNSELVAGWGNLVNRTASMI
AKSFGEIPAPGPLESIDQEILDEVARGFETVGDLIAHHRQKAGIAEAMRLVGEVNTYVSR
TEPFKLKGEDQRERLATVLHTLAQCVHDCNTILAPFLPHASNRVWATFGGEGEFMPMPRL
EHVEDLGPITTAPVDPSIAGDELRVYPIITGEYSTTPRWERRAVTVGSPVAKPTPVFVKL
DPSVVEEEMARMTGASGAAEPASATAAPGAPA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcctgtcagcagtcgcctggccgtatgccaacggcccccgccacatcggt
cacgtcgccggcttcggcgtcccgtccgacgtcttcagccgctacatgcggatggcgggc
cacgacgtgctgatggtgtccggcaccgacgagcacggcaccccgatcctcgtcgcggcg
gacaaggagggcgtcaccgcccaggagctggccgacaagaacaacgcggtcatcgtccag
gacctcgtcgacctgggtctgtcctacgacctgttcacccgcaccacgacccgcaaccac
tactcggtggtgcaggagatgttccgcgtctgccacgccaacggctacatggtcgaggag
accaccaagggcgcgatctccccgagcaccgggcgcacgctgccggaccgctacgtcgag
ggcacctgccccatctgcggcttccccgacgcccgcggcgaccagtgcgacaactgcggc
aaccagctggacccgaccgagctgatcgacccgcggtccaagatcaacggcgagacgccg
cagttcgtcgagacgcagcacttcttcctcgacctgcccgccctggccgaggcgctcacg
gtctggctcgacgggcgcgaggccaccggcacctggcggcccaacgtcatcaagttctcc
cagaacctcctcaaggacgtccggccgcgcgcgatgacgcgcgacatcgactggggcatc
ccggtgccgctggacgggtggcgcgaccagcgcaccaagcggctctacgtgtggttcgac
gcggtgatcggctacctctccgcgagcatcgagtgggcgcggcggatcggtgacgaggag
cgctggcgcgagtggtggagcgacgaggccggcgccgacgcgagctcctattacttccag
ggcaaggacaacatcaccttccactcccagatctggccggcggagctgctggcctacgcg
ggcgagggcgccaagggcggcgaggcgggcgtcttcggcgcgccgagcctgcccaccgag
gtcgtggccagcgagttcatgaccatggagggcaagcagttctcgtcctcgcgcggcgtg
gtcatctacgtcggcgacatgctgtcccgctaccagccggacgcgctgcgctacttcatc
tgcgccgcgggcccggagaaccaggactccgacttcacgtgggcggagttcgtgcagcgc
accaactccgagctggtcgcgggctggggcaacctggtcaaccgcacggccagcatgatc
gcgaagagcttcggcgagatccccgccccggggccgctggagtcgatcgaccaggagatc
ctggacgaggtcgcccgcggcttcgagacggtcggcgacctgatcgcccaccaccggcag
aaggccggcatcgccgaggccatgcgtctcgtcggcgaggtcaacacctatgtctcgcgc
accgagcccttcaagctcaagggcgaggaccagcgcgagcgtctcgcgaccgtgctgcac
acgctggcccagtgcgtgcacgactgcaacacgatcctggcgcccttcctgccgcacgcg
tccaaccgggtgtgggcgaccttcggcggcgagggcgagttcatgcccatgccgcgcctg
gagcacgtcgaggacctcggccccatcacgacggcgcccgtggacccctcgatcgcgggc
gacgagctgcgggtctacccgatcatcaccggggagtactccacgaccccccgctgggag
cgccgcgcggtgaccgtggggtcaccggtcgccaagcccaccccggtcttcgtcaagctc
gacccctcggtggtcgaggaggagatggcccgtatgacgggcgcctccggcgccgccgag
cccgccagcgccaccgccgcccccggggctccggcatga

DBGET integrated database retrieval system