KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_08375
Entry
ADJ73_08375       CDS       T04014                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00472  D-Arginine and D-ornithine metabolism
ars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ADJ73_08375
Enzymes [BR:ars01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ADJ73_08375
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF1127
Other DBs
NCBI-ProteinID: AKT51335
UniProt: A0A0K1F9H6
Position
1:1756595..1756987
AA seq 130 aa
MTDQDARLARFEQRRTQLDAMSDAQLKDRFWELSHEMMKPVVELARTHTSPSIERSILLR
MGIDSVSSHGVVDRIHDKGLLGKGAGHVVLKVAHQLGVDVRAAAAAIAADDTVLDGLFAS
TPATATGKGA
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaccgatcaggatgcacgcctggcgcgcttcgagcagcgccggacgcagctggacgcg
atgagcgacgcccagctcaaggaccggttctgggagctgagccacgagatgatgaagccc
gtcgtcgagctcgcccgcacccacacgagcccgtccatcgagcggagcatcctgctgcgc
atggggatcgactcggtgagcagccacggcgtggtcgaccggatccacgacaagggcctc
ctcggcaagggtgccggccatgtcgtcctcaaggtcgcgcaccagctcggggtcgacgtg
cgtgccgcggccgccgccatcgccgccgacgacaccgtcctggacggcctgttcgcgtcg
acccccgccaccgcgaccggcaagggagcctga

DBGET integrated database retrieval system