KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_08380
Entry
ADJ73_08380       CDS       T04014                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00472  D-Arginine and D-ornithine metabolism
ars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ADJ73_08380
Enzymes [BR:ars01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ADJ73_08380
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AKT51336
UniProt: A0A0K1FA75
Position
1:1756989..1759217
AA seq 742 aa
MTDQLDENVKLDIEDILSDLESYRPRRKGWVWREVPAEGVDLGPFHYRDMATPLAKSLGL
PASKYFGGIDPQPKCVVTTEIASGRFEDDIRRMRMAAWHGADHLMVIRTTGQSHIDGLLE
GTPEGIGGVPITRKQIRASRKACDLIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGINGA
HQDPQYNVLYRNVNMYRSFVDAAEAKKVMSGAGIFQIDGAHNANATAKAGWLVMPELMVQ
HGINSAFSVMVGMPTELIGLSTVPPNSSPAPKLWYDLPYAVALRDFFSDFKMRAQQNTRY
IEADIEEAVRTHTIDTLISMLTRADIQSTITPDEGRNVPWHYNNVRGLQTVKQTWSGLDG
INELLGLKHDGPLGEMVRDLKVRSVAFLEEAIEQGGYFAAVEKGFFVDSAKYPERNGDGI
ARDGQGGVGAGSIVERDEDYFAPVSCHFGDNHIPDFVHELVGRRVERPEDAIGGDTLSDP
DKIVYIDELDPEDSADARLEATKPYRTGGMIKPEAEWAGDGTVLIQLFVPEAEDIADVYA
VEMAKQMGLQDPEVVNLQPMHPSEGTFVEVKGKVAFAIDRSTLKIPEKEVMLPEEELREA
VGAVGLRVVAGTVGEDEHSVGLREILDIKHGGIEKYGVKYDYLGTSVPLGKIVDAAIETG
AHAILISTIISHNDVHRTMMRKLEELCREKGIRDRVVLIAGGTQVNREMAAETGLDATFG
RGTKGIHVVNAMVKTLRARGQV
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaccgaccagctcgacgagaacgtcaagctcgacatcgaggacatcctgtccgacctg
gagtcctaccgcccgcgccgcaagggctgggtgtggcgcgaggtgccggccgagggcgtc
gacctggggccgttccactaccgcgacatggcgaccccgctggccaagagcctgggcctg
ccggcgagcaagtacttcgggggcatcgacccgcagcccaagtgcgtcgtgacgaccgag
atcgcgagcggccgcttcgaggacgacatccgccgcatgcggatggccgcgtggcacggg
gccgaccacctcatggtgatccgcacgacggggcagtcgcacatcgacgggctgctcgag
ggcacgccggagggcatcggtggagtccccatcacccgcaagcagatccgcgcgtcccgc
aaggcctgcgacctgatcgaggacgaggtcgggcgcccgatcaacttccactcctacgtg
tccggcgtggccgggcccgaggtggctgtcctcttcgccgaggagggcatcaacggcgcc
caccaggacccgcagtacaacgtgctctaccgcaacgtcaacatgtaccgctccttcgtc
gacgcggcggaggccaagaaggtcatgagcggggccgggatcttccagatcgacggcgcg
cacaacgccaacgcgaccgccaaggccgggtggctggtcatgcccgagctgatggtgcag
cacggcatcaacagcgccttctcggtgatggtcggcatgcccaccgagctgatcgggctg
tcgaccgtgccgcccaacagctcgcccgcccccaagctctggtacgacctgccctacgcc
gtcgcgctgcgagacttcttctccgacttcaagatgcgggcccagcagaacacccgctac
atcgaggcggacatcgaggaggccgtgcgcacgcacaccatcgacaccctcatctcgatg
ctgacgcgcgccgacatccagtcgacgatcacgcccgacgagggccgcaacgtgccctgg
cactacaacaacgtgcgcggcctgcagaccgtcaagcagacctggagcgggctggacggg
atcaacgagctgctcggcctcaagcacgacggcccgctcggggagatggtgcgcgacctc
aaggtgcggtcggtggccttcctggaggaggccatcgagcagggcggctacttcgcggcg
gtggagaagggcttcttcgtcgactcggcgaagtaccccgagcgcaacggcgacggcatc
gcccgcgacggccagggcggcgtgggcgccgggtccatcgtggagcgcgacgaggactac
ttcgctccggtgtcctgccacttcggcgacaaccacatcccggacttcgtgcacgagctc
gtcgggcgccgggtcgagcgtcccgaggacgcgatcggcggcgacaccctgtccgacccc
gacaagatcgtctacatcgacgagctcgacccggaggactccgccgacgctcggctggag
gcgaccaagccctaccgcaccggcgggatgatcaagccggaggctgagtgggcgggcgac
gggacggtgctgatccagctcttcgtgcccgaggccgaggacatcgccgacgtgtatgcc
gtcgagatggccaagcagatggggctgcaggaccccgaggtggtcaacctgcagccgatg
cacccctcggagggcaccttcgtcgaggtcaagggcaaggtggccttcgccatcgaccgg
tccacgctgaagatccccgagaaggaggtcatgctccccgaggaggagctgcgcgaggcc
gtcggcgcggtcgggctgcgggtcgttgccggcaccgtcggcgaggacgagcatagcgtg
ggcctgcgcgagatcctcgacatcaagcacggcggcatcgagaagtacggcgtgaagtac
gactacctcggcacgtcggtgccgctcggcaagatcgtcgacgcggccatcgagacgggg
gcgcacgccatactcatcagcacgatcatcagtcacaacgacgtgcaccggacgatgatg
cgcaagctcgaggagctgtgccgggagaaggggatccgggaccgcgtggtgctgatcgcc
ggcgggacgcaggtcaaccgcgagatggccgccgagaccgggctcgacgcgaccttcggg
cgcggcaccaagggcatccacgtcgtcaacgccatggtcaagacgctgcgggcgcgcggc
caggtctga

DBGET integrated database retrieval system