KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_13880Help
Entry
ADJ73_13880       CDS       T04014                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00260  Glycine, serine and threonine metabolism
ars00630  Glyoxylate and dicarboxylate metabolism
ars00670  One carbon pool by folate
ars01100  Metabolic pathways
ars01110  Biosynthesis of secondary metabolites
ars01130  Biosynthesis of antibiotics
ars01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ADJ73_13880
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ADJ73_13880
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ADJ73_13880
Enzymes [BR:ars01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     ADJ73_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AKT52097
UniProt: A0A0K1FCF8
Position
1:complement(2968638..2969747)
Genome map
AA seq 369 aa AA seqDB search
MTETSLKKSPLHERHVALGAKMADFGGWEMPIEYPGGGVIREHTAVRERVGIFDVSHLGK
ARVVGEGAADFVNSCFTNDLRKVEPPKAQYTMCCDEQTGGVVDDLIQYVKSDDEVFLIPN
AANTTEVVRRMRDKLPEGLELTNLHEEYGVIAVQGPRAEDVVTALGLPTDLEYMSFAEAE
WNGRPVIVCRTGYTGEKGYELLPTWDNTPALWDALVEAMAPHDGLPCGLGARDTLRTEMG
YALHGHELSMDITPNMARAGWAVGWGKDAFWGKEVLEAQKAAKDCRLSWGLKVTGRGIPR
KDCVVKDAEGREIGVVTSGTMSPTLKQGIALCLLDRGAKEGDEVVVDVRGREVAAVVTKP
PFVQGGAAS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaacttcactgaagaagtcccccctccacgagaggcacgtcgcgctcggcgcc
aagatggccgacttcggcggctgggagatgccgatcgagtaccccggcggcggcgtgatc
cgcgagcacaccgcggtgcgcgagcgcgtcggcatcttcgacgtgtcccacctgggcaag
gcgagggtcgtcggcgagggcgccgccgacttcgtcaactcctgcttcaccaacgacctg
cgcaaggtcgagccgcccaaggcgcagtacaccatgtgctgcgacgagcagaccggcggc
gtcgtcgacgacctgatccagtacgtcaagagcgacgacgaggtcttcctcatccccaac
gctgccaacacgaccgaggtcgtgcgccggatgcgcgacaagctgcccgagggtctggag
ctgaccaacctgcacgaggagtatggcgtgatcgccgtgcaggggccccgcgccgaggac
gtggtcaccgccctgggcctgcccaccgacctggagtacatgtccttcgccgaggcggag
tggaacggccgtcccgtcatcgtgtgccgcaccggctacaccggcgagaagggctacgag
ctgctgccgacctgggacaacaccccggccctgtgggacgccctggtcgaggcgatggcg
ccgcacgacgggctgccgtgcggcctgggcgcgcgcgacacgctgcgcaccgagatgggc
tacgcgctgcacggtcacgagctgtcgatggacatcacccccaacatggcgcgcgccggc
tgggccgtcggctggggcaaggacgcgttctggggcaaggaggtcctggaggcgcagaag
gccgccaaggactgccgcctgtcctggggcctgaaggtcaccggccggggcatcccccgc
aaggactgcgtcgtcaaggacgccgagggccgcgagatcggcgtcgtcacctccgggacc
atgtcgcccaccctcaagcagggcatcgcgctgtgcctgctcgaccggggcgccaaggag
ggcgacgaggtcgtcgtggacgtgcgcggccgcgaggtcgccgccgtggtcacgaagccg
cccttcgtccagggtggtgccgcgagctga

DBGET integrated database retrieval system