KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_13895Help
Entry
ADJ73_13895       CDS       T04014                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00020  Citrate cycle (TCA cycle)
ars00310  Lysine degradation
ars00380  Tryptophan metabolism
ars01100  Metabolic pathways
ars01110  Biosynthesis of secondary metabolites
ars01120  Microbial metabolism in diverse environments
ars01130  Biosynthesis of antibiotics
ars01200  Carbon metabolism
Module
ars_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ars_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ADJ73_13895
  09105 Amino acid metabolism
   00310 Lysine degradation
    ADJ73_13895
   00380 Tryptophan metabolism
    ADJ73_13895
Enzymes [BR:ars01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ADJ73_13895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 TFIIF_alpha RR_TM4-6
Motif
Other DBs
NCBI-ProteinID: AKT52100
UniProt: A0A0K1FBQ4
Position
1:2973134..2975041
Genome map
AA seq 635 aa AA seqDB search
MSERVTMPALGESVTEGTVTRWLKSVGDAVEVDEPLLEVSTDKVDTEIPSPVAGTVQEIL
VEEDETVPVGADLAVIGDGDAPAKDDSSGDDASEDTSAAEQAKQSESSEPETEETVEETT
SATPSDEKEEPKKSSGDSGGNGSSGGSGSSGGSGSSGGSGSGGDRVTMPALGESVTEGTV
TRWLKAEGDEVEVDEPLLEVSTDKVDTEIPSPFAGTLTTILVQEDETAEVGADLAIIGGD
ASGGGSQDDSAQDDSSQDEPEQPAEEEPKQEAPKEEPKQEAKQEAPTEEAPKQEAPKKEA
PKEDAQKASAPRAEGGESDASAYVTPLVRKLAADNGVDLSTLTGTGVGGRIRKQDVLDAA
KKASEPAAAAPAATPSAPSAGAQAPTAVPTPDPVSAEKRGTTEKMPRLRKVIAQRMVESL
ATSAQLTAAVEVDMTRVVRLRARAKDEFQQREGVKLTYLPFITLAAIEALKAFPQLNSSI
DGDSIVYHGAEHVGIAVDTERGLLVPVIKDAGDLNIAGLSRKIADLADRTRTNKVGPDEL
GGATFTITNIGSNGSLLDTPIINQPNVGILGTGAIVKRPAVITDAEGNDAIAIRSMMYLV
LTYDHRAVDGALAGKFLSALKARLEEGRFESSLGL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcgtgacgatgcccgcccttggcgagtcggtgaccgagggcaccgtgacc
cgctggctcaagtccgtcggtgacgcggtggaggtggacgagccgttgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcgccggtggcggggacggtccaggagatcctc
gtcgaggaggacgagaccgtgcccgtgggcgccgacctcgccgtgatcggcgacggtgac
gccccggccaaggacgactcctcgggcgacgacgcctccgaggacacctccgccgccgag
caggccaagcagtccgagtcctcggagccggagaccgaggagacggtcgaggagaccacc
tccgccaccccctcggacgagaaggaagagcccaagaagtcctccggcgactccggcggc
aacggctcctcgggcggcagcggctcctcgggcggcagcggctcctcgggcgggtcgggt
tccggtggcgaccgggtcacgatgccggcgctcggcgagtccgtgaccgagggcaccgtc
acccgctggctcaaggccgagggcgacgaggtcgaggtcgacgagccgctcctcgaggtc
tccacggacaaggtcgacaccgagatcccctcccccttcgccgggacgctcaccacgatc
ctggtgcaggaggacgagacggccgaggtcggcgctgacctcgcgatcatcggtggggac
gcgtccggcggcggctcgcaggacgactccgctcaggacgactcctcgcaggacgagccc
gagcagcccgccgaggaggagccgaagcaggaggctccgaaggaggagcccaagcaggag
gcgaagcaggaagcccccacggaggaggctcccaagcaggaggctccgaagaaggaggct
cccaaggaggacgctcagaaggcctcggcgccccgcgcggagggtggcgagtcggacgcg
tccgcctacgtcactcccctggtccgcaagctcgccgccgacaacggcgtggacctgtcc
acgctgaccggcaccggcgtgggtggccgcatccgcaagcaggacgtgctcgacgccgcc
aagaaggcctccgagcccgccgccgcagcccctgccgcgactccgtcggctccgtcggcc
ggcgcgcaggcgccgacggcggtcccgaccccggaccccgtgtccgccgagaagcgtggc
accaccgagaagatgccgcgcctgcgcaaggtcatcgcgcagcgcatggtggagtcgctc
gcgacctcggcccagctgaccgcggccgtcgaggtggacatgacccgggtggtgcggctg
cgcgcccgcgccaaggacgagttccagcagcgcgagggcgtcaagctcacctacctgccg
ttcatcacgctggcggcgatcgaggccctcaaggcgttcccgcagctcaactccagcatc
gacggcgactcgatcgtctaccacggcgccgagcacgtcggcatcgcggtggacaccgag
cggggcctgctggtcccggtgatcaaggacgccggtgacctcaacatcgccggtctgtcc
cgcaagatcgccgacctcgccgaccgcacccgcaccaacaaggtgggtccggacgagctg
ggtggcgcgaccttcacgatcaccaacatcgggtccaacggctcgctgctcgacaccccc
atcatcaaccagcccaacgtcggcatcctcggcacgggcgccatcgtcaagcgtcccgcg
gtcatcaccgacgccgagggcaacgacgcgatcgcgatccgctcgatgatgtacctcgtg
ctcacctacgaccaccgcgcggtcgacggtgcgctcgcgggcaagttcctctcggcgctc
aaggcgcgcctggaggagggccgcttcgagtcctcgctggggctgtga

DBGET integrated database retrieval system