KEGG   Arthrobacter sp. FB24: Arth_0083Help
Entry
Arth_0083         CDS       T00421                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
art  Arthrobacter sp. FB24
Pathway
art00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arth_0083
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Arth_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: ABK01484
UniProt: A0JR14
Position
85137..86111
Genome map
AA seq 324 aa AA seqDB search
MSAGAEAHGRIVVVGSLNADLTIYCERLPLPGETVHGTGFAVNPGGKSANQAVAASLLGG
AVSLVGAVGDDSNGEMLLSSTAGAGVDISHVRTSESAATGVAVIAVDAHGENNIIISAGA
NGTLAPADVAASADVFAGASVVCLCLEVSLDTVEAAARTGHDAGATVLLNLSPYGEIPPG
LAELTDVLLVNAHEASLFLGSGEMPGAEAHDAAWDGVRERFAERGLQRVLVTLGASGSVV
LDSLVSGTDRVTRTAPVTVHAVDTTGAGDAFTGAVAARLAAGEPLAEAAAFASVAAALAA
TRKGTQAAYAGVADVERMRARLLS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccggagcggaagcgcacggccggatcgtcgtcgtcggctccctgaatgcggac
ctgactatctactgcgaacggctcccgctgccgggagagacggtccacggcaccggattc
gccgtgaatcccggtggcaagagcgccaaccaggccgtggcagccagcctgctgggcggg
gcggtcagcctcgtcggcgccgtgggggacgactccaacggcgagatgctcctctcctca
accgccggcgccggcgtggacatctcgcacgtgcgcacctcggagtccgccgctacggga
gtcgccgtgatcgcggtggacgcgcacggcgagaacaacatcattatctcggcgggagcc
aacggaacccttgctcccgccgacgtcgcggcgtcagcggacgtgttcgccggcgcctcc
gtggtgtgtctctgcctagaggtcagcctggacaccgttgaagccgccgcccggacaggg
cacgacgccggcgcgacagtcctgctcaacctctcaccttatggcgagatccccccgggc
ctggcggaactgaccgatgtcctgctggtcaatgcgcacgaggcgtcgctgtttctgggg
tccggggagatgcctggtgcggaagcgcacgacgccgcgtgggatggcgtccgggagcgt
ttcgccgagcgcgggctacagcgggtcctggtcactttgggggccagcggctcggtagtg
ctcgactcgctggtttcagggacggaccgtgtcacccggaccgcgccggtcacggtccat
gcggtggacaccacgggcgccggtgatgcgttcaccggcgccgtggccgcacggctcgcc
gccggcgagccgctcgccgaagccgctgccttcgcctccgtggcggcggcactcgccgct
acccggaagggcacgcaggctgcctacgccggcgtggccgacgtggagcggatgagggcg
agattgcttagctag

DBGET integrated database retrieval system