KEGG   Arthrobacter sp. FB24: Arth_0152Help
Entry
Arth_0152         CDS       T00421                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
art  Arthrobacter sp. FB24
Pathway
art00790  Folate biosynthesis
art01100  Metabolic pathways
Module
art_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arth_0152
Enzymes [BR:art01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Arth_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABK01553
UniProt: A0JR83
Position
157535..158179
Genome map
AA seq 214 aa AA seqDB search
MTHFDDDDVSAGPGPSAADHAQHAGHIKVDRPRIEAAVREILLAIGEDPDRGGLLDTPKR
VAKAYAEVFAGLHHDPAEILSTTFDLDHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIP
SHDGKVTGLSKLARLVDMFAKRPQVQERLTTQIVEALVTHLKPRGAIVVVECEHLCMSMR
GIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgactcatttcgacgacgacgacgtttccgccggccccggcccctcagctgcagaccac
gcgcagcatgccggccatatcaaggttgaccggccacggatcgaggcggcggtcagggaa
atcctgctggccatcggggaagacccggaccgcggcggcctcctggacacccctaaaagg
gtggccaaggcctacgcagaggtcttcgccggcctgcaccacgaccccgcggaaatcctg
tccaccaccttcgacctggaccatgaggagctggtcctggtcaaggacatcccgttctac
tccacctgcgagcaccacctggtgccgttccacggcgtggcgcacgttggctacattccg
tcccacgacggcaaggtcacggggctgagcaagctcgccaggctggtggacatgttcgcc
aaacgcccccaggtgcaggaacggctcactacccagatcgtcgaagcactggtaacgcac
ctcaagccgcgcggagcgatcgtggtcgtggaatgcgaacacctgtgcatgtccatgcgc
ggcatccgcaagcccggtgccaagaccgtcaccagcgccgtgcgcggtcaactgcatgac
ccggccacccgtgccgaagccatgagcctcatactcggaaggtaa

DBGET integrated database retrieval system