KEGG   Arthrobacter sp. FB24: Arth_0366Help
Entry
Arth_0366         CDS       T00421                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
art  Arthrobacter sp. FB24
Pathway
art00072  Synthesis and degradation of ketone bodies
art00650  Butanoate metabolism
art01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Arth_0366
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Arth_0366
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Arth_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR Shikimate_DH Sacchrp_dh_NADP AdoHcyase_NAD Urocanase F420_oxidored 3Beta_HSD TrkA_N GDP_Man_Dehyd Polysacc_synt_2 Glu_dehyd_C NmrA NAD_binding_7 3HCDH_N AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABK01767
UniProt: A0JRU7
Position
387646..388395
Genome map
AA seq 249 aa AA seqDB search
MEHTLNGRKALVTGGAGGIGAASVRALAARGAKVVIADVDEAAAAALADEVGGTVWAVDL
LDVDALATTSLDCDILVNNAGIQRISPIEDFDPADFRRLITLMLEAPFLLIRAALPHMYA
NNFGRIINLSSVHGLRASPFKSAYVSAKHGLEGLSKVTALEGGAHGVTSNCINPGYVRTP
LVESQIADQAKVHGIPESEVLAKIMLTESAIKRLVEPEEVASLVAWLASNDAGMVTGASY
TMDGGWSAR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgctgaacggccgcaaggcactggtcaccggaggagccggcgggatcggc
gcagccagtgtgagggccctggccgcacggggcgccaaagtggtgatcgcggacgtggac
gaggccgctgcggcagcactcgccgatgaagtcggcggtacggtctgggcggtggacctg
ctggacgtggatgccctggcaaccaccagcctggactgcgacatcctggtcaacaacgcc
ggaatccagcgcatcagccctattgaggacttcgatccggctgatttccgccggctcatc
accctcatgctggaggcgcccttcctgctgatccgggcggcgctgccacacatgtatgcg
aacaacttcggccggatcatcaacctctcgtcggtgcacgggctccgggcctccccgttc
aagagcgcctacgtttccgccaagcacggtcttgaagggctgagtaaggtgacggcgctg
gagggcggggctcacggggtcacgtccaactgcatcaaccccggctacgtgcgcacgccc
ctggtggagtcgcagatcgccgaccaggccaaggtccacggcatccccgaatccgaggtg
ctggccaagatcatgctcaccgagtccgccatcaagcggctggtggagccggaggaggtc
gcatctctggtcgcctggctcgcctcgaacgacgccggcatggtcactggagccagctac
accatggacggcggctggtcggcgcggtag

DBGET integrated database retrieval system