KEGG   Arthrobacter sp. FB24: Arth_0423Help
Entry
Arth_0423         CDS       T00421                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
art  Arthrobacter sp. FB24
Pathway
art00071  Fatty acid degradation
art00280  Valine, leucine and isoleucine degradation
art00281  Geraniol degradation
art00310  Lysine degradation
art00360  Phenylalanine metabolism
art00362  Benzoate degradation
art00380  Tryptophan metabolism
art00410  beta-Alanine metabolism
art00627  Aminobenzoate degradation
art00640  Propanoate metabolism
art00650  Butanoate metabolism
art00903  Limonene and pinene degradation
art00930  Caprolactam degradation
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arth_0423
   00650 Butanoate metabolism
    Arth_0423
  Lipid metabolism
   00071 Fatty acid degradation
    Arth_0423
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arth_0423
   00310 Lysine degradation
    Arth_0423
   00360 Phenylalanine metabolism
    Arth_0423
   00380 Tryptophan metabolism
    Arth_0423
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arth_0423
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arth_0423
   00281 Geraniol degradation
    Arth_0423
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arth_0423
   00627 Aminobenzoate degradation
    Arth_0423
   00930 Caprolactam degradation
    Arth_0423
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arth_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABK01824
UniProt: A0JS04
Position
452552..453331
Genome map
AA seq 259 aa AA seqDB search
MTEEYGNILVEQRGRVGLVTLNRPEALNALNKATMDELVAAVTAMDSDPGVGAVVVTGSG
KAFAAGADIKEMAAQGYMDMYAADWFRGWEDFTRLRIPVVAAVSGFALGGGCELAMMCDF
IIAGDNAKFGQPEINLGVLPGMGGSQRLTRAVGKAKAMDLILTGRFMDAEEAERAGLVSR
VVPAADVVDEAVKVAEVIASKSKSAAMVAKESVNAAFETGLAQGVLFERRLFHSLFATDD
QKEGMAAFTEKRQPEFKHR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagagtacgggaacattctggtggaacagcgcggacgcgtggggctggtgacg
ctcaaccgcccggaagcactgaacgcgctgaacaaggccaccatggacgaactcgttgct
gcggtcacggccatggactcggatcccggcgtgggcgccgtggtggtcaccggctccggc
aaggcgttcgccgccggtgcggacatcaaggagatggctgcccagggctacatggacatg
tacgctgcggactggttccgcggctgggaggatttcaccaggctccggattccggtggtg
gcggctgtctcgggttttgccctgggcggcggctgcgaactggccatgatgtgcgatttc
atcatcgccggggacaacgccaagttcggccagcccgagatcaacctgggcgtcctgccg
ggcatgggcggatcgcagcggctcacccgggccgtgggcaaggccaaggccatggacctg
atcctcaccgggcggttcatggacgcggaggaggccgagcgtgccggactggtgtcccgg
gtggtgccggccgctgacgtggtggacgaggccgtgaaagtggccgaggtgattgcgtcc
aagtcgaagtcggcggccatggtggccaaggagtccgtcaacgccgcgtttgaaacggga
ctggcccagggggtgcttttcgaacggcgcctcttccactcgctgttcgccaccgatgac
cagaaggaaggcatggccgccttcacggagaagcgccagcccgagttcaagcaccgttag

DBGET integrated database retrieval system