KEGG   Arthrobacter sp. FB24: Arth_0663
Entry
Arth_0663         CDS       T00421                                 

Name
(GenBank) ABC-2 type transporter
  KO
K01421  putative membrane protein
Organism
art  Arthrobacter sp. FB24
Brite
KEGG Orthology (KO) [BR:art00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Arth_0663
SSDB
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane
Other DBs
NCBI-ProteinID: ABK02062
UniProt: A0JSP2
Position
complement(705362..707398)
AA seq 678 aa
MTVLRLARSELKRMTGGLLPKLTILALTMVPLLYGAVYLYANWDPYSNLDQIDAALVVED
TGATSSDGTQLQAGRKVADSLIDGHVFNWQSVDSAEQADQGVSSGKYAFALKIPKDFSAN
LVSPGSFDAANQAMLNVTTNDANNYLLSTIVDKLTTAVHSSVAKEVGEETANQLLTGFGT
IHTQMVKAADGAGQLSDGVSKLHDGTVTLHEGTSQLSSGAGELYNGQLKLRDGANQLNDG
AAQLSDGLSQLQDKTASLPADSQKLADGAAQVAAGNATLNTKVQDVVGQLDAADQGLRNR
VVESNGRLMAAGIITQAQADSILKDFDAAAASGPVADAKAKIQSDAAQIQQLSDGSSAVS
AGAARLAAATPALTGAIAQASAGADQLHTGTSALAAGEQSAVDGTAKLAEGAGTLDSGAA
QLEDGATTAANGAATLASELGKGAGQVPNPDDAQKSSLSKVMADPVAVSNVSQAKAGSYG
AGLAPFFLTLALWIGIFMLIQAMRPVTQRALASNAPSWKIALGGWLPFLAVSVVQASLLT
LVVDVALGLNPAHPVLMWLFMLAAAMAFSAIIQGIVALLGSPGKLVVLILLVLQLVSSGG
TFPWQTTPQPLHLVHEILPMGYVVTGMRHLIYGADLSMILPIVAGLLGYTVLGAALSTLA
VHKHKFWTLKSLKPEIAV
NT seq 2037 nt   +upstreamnt  +downstreamnt
gtgactgtgctgcggctggcccgctccgaactcaagcgcatgaccggcgggctgctgccc
aagctgaccatccttgccctgaccatggtgcccctgctctacggggctgtgtacctgtac
gccaactgggatccgtacagcaacctggaccagatcgacgcggcgctggtggtggaggac
acgggcgccacctccagcgacggaacgcagctgcaggccggccggaaggtggcggacagc
ctcatcgacggtcacgtgttcaactggcagtccgtggattccgccgaacaggccgaccag
ggagtcagcagcggcaagtacgccttcgccttgaagattccgaaggatttttccgccaac
ctggtgtcccccggcagcttcgacgccgccaaccaggccatgctgaacgtgaccaccaac
gacgccaataactacttgctgagcactatcgtggacaagctgaccactgccgtccactcg
agtgtggccaaggaagtgggcgaggaaaccgccaaccagctgctcaccggcttcggcacc
atccacacacagatggtcaaagcggctgacggcgccggccagctttccgacggcgtcagc
aagctccacgacggcaccgtcaccctgcacgagggaacctcgcagctcagcagcggcgcc
ggggaactctacaatggccagctcaagctgcgcgacggtgccaaccagctgaacgacggc
gcggcacagctcagcgacggactcagccaactgcaggacaagacagcctcactcccggcg
gattcgcagaaactggctgacggcgccgcccaggtagcggccggaaacgccacgctgaac
accaaggtgcaggacgtcgtggggcaattggacgccgcggaccagggactgcggaaccgc
gtggtggaatccaacggcaggctgatggccgcgggcatcatcacccaggcgcaggcggac
agcatcctcaaggacttcgacgcagctgcggcatccggaccggtggcggacgccaaggca
aaaatccagtccgacgccgcgcagatccagcagctttcggacggttcgtccgcggtgagc
gccggtgccgccaggctcgcggcggccacacccgccctgaccggcgccatcgcccaggcg
tccgcgggcgcggaccagttgcacaccgggacctccgcgttggccgccggggagcaaagc
gccgtggacggcacagcgaagcttgccgaaggtgccgggacgctcgacagcggcgcagcg
cagcttgaagacggtgccacaacggccgccaacggagcagccacgctggcctcggaactc
ggcaagggcgccggccaggtgcccaatcccgatgacgcccagaagagcagcctctcgaag
gtcatggccgatcccgtggccgtcagcaacgtctcccaggcgaaggccgggtcctacgga
gccggcctggcaccgttcttcctgaccctcgcgctgtggatcggcatcttcatgctgatc
caggccatgcgtcccgtcacccagcgggcgctggcttccaacgcgccgtcgtggaagatt
gccctgggcggctggctgccgttcctggccgtctccgttgtccaggcgagcctgctcacc
ctggtggtggacgtggcgctgggcctcaaccccgcgcatccggtgctgatgtggctgttc
atgctggccgccgcgatggccttcagcgccatcatccagggcatagtggccctgcttggc
tcccccggaaagctggtggtcctgatcctgctggtgctccagctggtgtcctcgggcggc
acgttcccctggcagaccaccccccagccactgcatctggtgcacgaaatcctccccatg
ggctacgtcgtgaccggcatgcggcacctgatctacggcgcggacctttccatgatcctg
cccatcgtggcgggcctgcttggctacactgtgctgggggccgcgctgtcaacgctggcc
gtccacaagcacaagttctggaccctgaagtccctgaaaccggagatcgccgtatga

DBGET integrated database retrieval system